KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338737
Entry
4338737           CDS       T01015                                 
Name
(RefSeq) fructose-bisphosphate aldolase cytoplasmic isozyme
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4338737
   00030 Pentose phosphate pathway
    4338737
   00051 Fructose and mannose metabolism
    4338737
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4338737
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4338737
   03036 Chromosome and associated proteins [BR:osa03036]
    4338737
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4338737
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     4338737
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4338737
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4338737
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4338737
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 4338737
NCBI-ProteinID: XP_015639252
UniProt: P17784
LinkDB
Position
5:19606722..19608915
AA seq 358 aa
MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF
CTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTT
QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP
IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAKKVSP
EVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLSTKKPWSLSFSFGRAL
QQSTLKAWSGKAENIEKARAAFLTRCKANSEATLGTYKGDAVLGEGASESLHVKDYKY
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtcggcctactgcggcaagtacaaggacgagctcatcaagaacgctgcctacattggc
actcctggcaagggtatccttgctgcggatgagtccactggcaccattggcaagcgcttc
gccagcatcaacgtcgagaacgttgaggagaaccgccgctccctccgcgagctcctcttc
tgcacccctggcgccctccagtacctcagcggcgtgatcctcttcgaggagaccctgtac
cagaagaccaaggatggcaagcccttcgtcgatgtcctcaaggagggtggtgtcctcccg
ggcatcaaggtggacaagggcacaatcgaggttgccggcaccgagaaggagaccaccacc
cagggccatgatgaccttggcaagagatgcgccaagtactacgaggctggtgcccgcttc
gccaagtggcgcgccgtcctcaagatcggccccaacgagccgtcgcagctcgccattgat
ctgaatgcgcagggcctcgctcgctacgccatcatctgccaggagaacgggctggtgccg
atcgtcgagcccgagatccttgttgatggccctcacgacatcgaccgctgcgcctacgtc
tcggaggtggtcctcgctgcgtgctacaaggccctcaacgagcaccatgtcctcctcgag
ggtaccctcctcaagcccaacatggtcaccccaggctctgacgccaagaaggtgtctccc
gaggtcatcgctgagtacaccgtccgcaccctccagaggaccgtccccgctgccgtgccc
gccatcgtcttcctgtccggtgggcagagcgaggaggaggcgaccctgaacctcaacgcc
atgaacaagctcagcaccaagaagccgtggtcgctgtccttctccttcggccgtgccctc
cagcagagcacgctcaaggcctggtccggcaaggcggagaacattgagaaggccagggcg
gccttccttaccaggtgcaaggccaactccgaggctaccctcggtacatacaagggtgac
gctgtcctcggcgagggcgcctccgagagccttcacgtcaaggactacaagtactga

DBGET integrated database retrieval system