KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338912
Entry
4338912           CDS       T01015                                 
Name
(RefSeq) fructose-1,6-bisphosphatase, cytosolic
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4338912
   00030 Pentose phosphate pathway
    4338912
   00051 Fructose and mannose metabolism
    4338912
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4338912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4338912
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     4338912
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4338912
SSDB
Motif
Pfam: FBPase FBPase_C zf_CCCH_4
Other DBs
NCBI-GeneID: 4338912
NCBI-ProteinID: XP_015640172
UniProt: A7J2C3
LinkDB
Position
5:complement(21493904..21496845)
AA seq 341 aa
MDHAAEAQRTDLMTITRHVLNEQGRHPESRGDFTILLSHIVLGCKFVASAVNKAGLAKLI
GLAGDTNVQGEEQKKLDVLSNEVFVKALVSSGRTCVLVSEENEEAIIVDAPLRGKYCVCF
DPLDGSSNIDCGVSIGTIFGIYMIKDKDNVTLDDVLQPGTDMLAAGYCMYGSSCTLVLST
GNGVNGFTLDPSLGEFILTHPNIKIPNRGKIYSVNEGNAKNWDAPTAKFVEKCKFPQDGS
PSKSLRYIGSMVADVHRTLLYGGIFLYPADQKSPNGKLRVLYEVFPMSFLMEQAGGQAFT
GKQRALELVPRKIHDRSPIFLGSYDDVEDIKALYASESIIG
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggatcacgcggcggaggcgcagaggacggacctgatgacgatcacgcggcacgtgctg
aacgagcagggccggcacccggagtcgcggggggacttcaccatcctactctcccacatc
gtcctcggctgcaagttcgtcgcctccgccgtcaacaaggccggcctcgccaagctcatc
ggcctcgccggcgacaccaacgtccagggtgaggagcagaagaagcttgacgtgctctcc
aacgaagtcttcgtcaaggcgctcgtcagcagcggccgcacgtgtgttcttgtgtctgaa
gagaacgaggaggccattatcgtcgacgctcccctccgcggaaagtattgcgtttgtttt
gatccactggatggctcctcaaatatcgattgtggtgtctccatcgggacgatctttggg
atttacatgattaaagacaaggacaacgtgactttggacgatgtactgcaacctggaaca
gacatgcttgctgctggctactgcatgtacgggagttcatgcacgcttgtgttgagcact
ggaaatggagtaaacggtttcacccttgatccttcccttggggagttcattctgactcat
ccaaacatcaagataccaaatagaggaaagatctattcagtgaacgaagggaatgcgaaa
aattgggatgctcctacagcgaagtttgtggagaaatgtaaatttccccaggatggttcg
ccttctaaatccttgagatacatcggaagtatggttgctgatgtccaccgtactttgcta
tatggaggcatatttttgtaccctgcggatcagaagagcccaaacggaaaacttcgtgtt
ctgtacgaagtgttcccaatgtcattcttgatggagcaagctggaggacaagctttcaca
ggcaaacaacgggcccttgaacttgttcccagaaagattcatgatagatctccaatattc
ctggggagctatgatgacgtggaggatatcaaagcattgtacgcttcagagtctatcatc
ggttga

DBGET integrated database retrieval system