KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338981
Entry
4338981           CDS       T01015                                 
Name
(RefSeq) uracil phosphoribosyltransferase
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4338981
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     4338981
SSDB
Motif
Pfam: UPRTase Pribosyltran
Other DBs
NCBI-GeneID: 4338981
NCBI-ProteinID: XP_015640328
UniProt: Q60EM2 A0A0P0WNA7
LinkDB
Position
5:complement(22387966..22392455)
AA seq 301 aa
MPSLATAAAAGAGAPLRRGPCAPRRQSAHASSSSSSSLPSPALATSTRFAATAPILRLVQ
RRPRAPLTAARAASPDAATGARSPSSGGQMLVFVPPHPLIKHWVSVLRNEQTPCAIFKSA
MAELGRLLIYEASRDWLPTITGEIQTPVAVSSVEFIDPREPVMVVPILRAGLAMAENASS
VLPATKTYHLGLRRDEETLQPSIYLNNLPDKIPEGTRVLVVDPMLATGGTIVAAIDLLVE
RGVTSKQIKVVSAVAAPPALQKLSNKFPGLHVYTGTIDSEVDERGFIVPGLGDAGDRSFA
T
NT seq 906 nt   +upstreamnt  +downstreamnt
atgccgtcgctcgccacggccgcggccgcgggagcgggagcgcctctccgccgcggcccg
tgcgcaccacgccgccaatccgcgcacgcctcctcctcctcctcctcctccctcccctcc
cccgcgctcgccacgtccacgcgcttcgccgccaccgcccccatcctgcggctcgtccaa
cgaaggccaagagcgcctctgacggcggcaagagcggcgagccccgacgccgccacgggg
gcgcgatcgccctcctccggcggccagatgctggtgttcgtgccgccgcacccgctgata
aagcactgggtctccgtcctgcgcaacgagcagacgccctgcgccatcttcaagagtgcc
atggcggagcttggtcggttgcttatatatgaagcttccagagattggctgccaacaatc
acaggagagatccaaacacctgtagctgtttcaagtgttgaatttattgacccaagagag
cctgtcatggttgttccgatactaagagctggtcttgctatggctgaaaatgcttcatca
gttctaccagccaccaagacttatcaccttggcctgcgtagggatgaagaaacacttcaa
ccttcgatatatctgaacaacttgccagacaagattccagaggggactcgtgtgctagtt
gttgatccaatgctggccactggtgggacaattgttgctgctattgacttgttggttgaa
cgtggagttacaagcaagcagattaaagtcgtttctgctgttgcagcgcctcctgcgctt
caaaagctcagcaacaaattccctgggcttcatgtgtacacgggaacaattgattctgaa
gttgatgagagagggttcatagttccggggttgggagatgccggcgatagaagcttcgcg
acttaa

DBGET integrated database retrieval system