KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339099
Entry
4339099           CDS       T01015                                 
Name
(RefSeq) DNA replication licensing factor MCM3
  KO
K02541  DNA replication licensing factor MCM3 [EC:5.6.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4339099
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4339099
   03036 Chromosome and associated proteins [BR:osa03036]
    4339099
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4339099
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4339099
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4339099
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_3 AAA_5 Sigma54_activat AAA
Other DBs
NCBI-GeneID: 4339099
NCBI-ProteinID: XP_015637328
UniProt: Q0DHC4
LinkDB
Position
5:23419588..23424596
AA seq 770 aa
MDVNEEAMAAHKRAFLDFLDQDVGKGVYMQAVRDMVQNKRHRLIIGMDDLRNHSLDLARR
VIRSPAEYMQPASDAVTEVARNLDPKFLKEGQRVLVGFSGPFGFHRVTPRDLMSSFIGTM
VCVEGIVTKCSLVRPKVVKSVHYCPATGGTLSREYRDITSFVGLPTGSVYPTRDENGNLL
VTEYGMCEYKDHQTLSMQEVPENSAPGQLPRTVDIIVEDDLVDSCKPGDRVSIVGVYKAL
PGKSKGSVSGVFRTVLIANNVSLMNKEANAPVYTREDLKRMKEISRRNDTFDLLGNSLAP
SIYGHLWIKKAVVLLMLGGVEKNLKNGTHLRGDINMMMVGDPSVAKSQLLRAVMNIAPLA
ISTTGRGSSGVGLTAAVTSDQETGERRLEAGAMVLADRGVVCIDEFDKMNDQDRVAIHEV
MEQQTVTIAKAGIHASLNARCSVIAAANPIYGTYDRSLTPTKNIGLPDSLLSRFDLLFIV
LDQMDPEIDRQISEHVARMHRYCTDDGGARSLDKTGYAEEDDGDVNAAIFVKYDRMLHGQ
DRRRGKKSKQDRLTVKFLKKYIHYAKNLIQPRLTDEASDHIATSYAELRDGGANAKSGGG
TLPITARTLETIIRLSTAHAKMKLRHEVLKTDVEAALQVLNFAIYHKELTEMEEREQREM
EMKQQADHDAGASGGNADEHRSSGNDPMDVDVGNASNDQDVPAERIEAFEAILGQHVLAN
HLDQISIDEIEQTVNREAAAPYNRRQVEFILERMQDANRIMIRDGIVRII
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggacgtcaacgaggaggcaatggcggcgcacaagcgcgcgttcctcgacttcctcgac
caggatgtcgggaagggggtgtacatgcaggccgtgcgcgacatggtgcagaacaagcgc
caccggctcatcatcggcatggacgacctccggaaccacagcctcgatctcgcccgcagg
gtgatacggagccccgcggagtacatgcagccggcgtcggacgcggtgacggaggtggcg
aggaacctggaccccaagttcttgaaggaagggcagcgcgtgctggtgggattctcgggg
cccttcggcttccacagggtcacgcccagggacctcatgtcgtccttcatcgggactatg
gtctgcgtcgagggcatcgtcacgaaatgttcactagtaaggccgaaagttgttaagagt
gttcactattgccctgctactggaggtactctctcacgtgaatacagggacatcacatct
ttcgtaggcctacctactggttcggtttatccaacaagggatgaaaatggtaacttgttg
gtcactgagtacgggatgtgtgaatacaaggatcaccaaacactctccatgcaagaagtg
cctgaaaattctgcccctggacagctcccaagaacagtggacattattgtagaagatgac
ctagtagattcttgcaagccaggtgaccgagtatcaattgttggtgtttacaaggctctt
ccagggaaaagcaagggcagtgttagtggtgtgttcaggactgtccttattgcaaacaat
gtttcacttatgaacaaagaagcaaatgcacctgtctatactcgggaggatttgaagagg
atgaaagaaatatcaaggagaaatgacacatttgacttactaggaaattcacttgctcca
tctatatatggccatctgtggataaagaaagcagtagttctattaatgcttggtggtgta
gagaagaatctgaagaatggaactcacttgagaggagatataaacatgatgatggtagga
gatccttcagttgccaagtcccagctcctaagagcggttatgaacattgcccctttggct
atttcaactactggaaggggttcatctggtgttggtttgaccgctgctgtcacttctgat
caagagactggtgagagaaggctggaggctggtgccatggttcttgctgatcgtggtgtt
gtctgcattgatgagtttgataagatgaatgatcaggaccgagtggctattcatgaagtt
atggaacagcaaactgtgacgattgcaaaggcaggaattcatgcgtcactaaatgcgaga
tgtagtgtgattgctgcagcaaatccaatatatggaacttatgaccgttcattgacacca
accaagaacattgggcttccagattcattactctcacgttttgatttgctttttattgtt
cttgatcaaatggatcctgagattgatcgtcaaatttctgaacatgttgcacggatgcat
agatattgcactgatgatggaggagcaagatctcttgataaaacaggatatgctgaagaa
gatgatggtgatgttaatgcagccatatttgttaaatatgatagaatgctccatgggcag
gacagaaggagaggcaagaaatccaaacaggacagactgactgtcaaattcctgaagaaa
tatattcattatgcaaagaaccttattcagccaagactaactgatgaggcatctgatcat
attgcaacttcatatgctgagctcagggatggtggtgcaaatgcaaagtctggtggaggt
acacttccgatcacagcgaggacactggaaaccataattcgtctatctactgctcatgcc
aagatgaaattgagacatgaggttctaaaaactgacgttgaagctgcactgcaagttctg
aattttgcaatataccacaaagagttaactgagatggaagagcgtgaacagagagagatg
gaaatgaaacaacaagctgatcatgatgcaggtgcaagtggtggtaatgcagatgagcat
agaagttctggaaacgacccaatggatgtggatgtaggaaatgcatcgaatgatcaggat
gttcctgcggagagaattgaagcatttgaggcgattcttggtcagcatgtgttggcaaat
catctcgatcaaatatcaattgacgaaattgagcaaactgttaatagagaggcagctgca
ccttacaatagacgtcaagtagaattcattttggagaggatgcaagatgcaaacaggata
atgatacgagatggcatcgttcggataatctaa

DBGET integrated database retrieval system