KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339305
Entry
4339305           CDS       T01015                                 
Name
(RefSeq) proline iminopeptidase isoform X1
  KO
K01259  proline iminopeptidase [EC:3.4.11.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4339305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4339305
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.5  prolyl aminopeptidase
     4339305
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S33
   4339305
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_4
Other DBs
NCBI-GeneID: 4339305
NCBI-ProteinID: XP_015638755
LinkDB
Position
5:complement(25477073..25484366)
AA seq 392 aa
MIRALRATSSPRTPTPTPTLPTSRRPRPPPPPPAPSTAGGRQGLGCHLRCRATLAAATNA
PMGQLQQQHQEQPLRKDLYPQTEPYDFGFLKVSGVHTIYYEQSGNPQGHPVVFLHGGPGA
GTSPGNRRFFDPEFFRIVLFDQRGAGRSTPHACLEENTTWDLVADIEKLREHLGIPEWQV
FGGSWGSTLALAYSESHPDKVTGIVLRGIFLLRKKELDWFYEGGAAAIFPDAWEPFRDFI
PEDERNCFIAAYSKRLTSSDADVQAEAAKRWTMWEMMTAHLIQNHENIKRGEDDKFSLAF
ARIENHYFVNKGFLPSDSHLLDNVDKIRHIKAFIVQGRYDVCCPMMSAWDLHKAWPEAEF
KMVPDAGHSANEVGVAAELVSANEKLKSMFTK
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgatccgcgcgctccgtgccacctcctccccccgaaccccaaccccaaccccaaccctc
cccacctcccgccgcccacgcccgccgcctcctcctcccgccccatccactgcaggggga
cgacagggtttgggctgccacctccgttgccgcgccaccctcgccgccgcaaccaacgcg
ccgatggggcaactgcagcagcagcaccaggagcagccgctgaggaaggatctgtacccg
caaaccgagccctacgatttcgggttcctcaaggtctccggcgtccacaccatctactac
gagcagtccgggaacccccagggccatcctgttgtgttcctccatggcggccctggagct
ggcacgtcgcccgggaatcggaggttctttgatccggagttcttcaggatcgttttgttc
gatcagagaggtgcaggcagaagcactcctcacgcgtgtttggaagagaacactacctgg
gacttggttgctgacatcgagaagcttagagaacatcttggcatcccagagtggcaggtg
tttggtggttcatggggaagcaccttggctctcgcgtacagcgagagtcaccctgataag
gtcactggcattgttctaagaggcattttcttgcttaggaaaaaggaacttgattggttc
tatgagggtggtgcagcagctattttcccagatgcatgggaaccatttagagattttatt
cctgaggatgaaaggaattgtttcatagctgcttatagcaaaaggctaacttcctctgat
gctgatgtccaggctgaagctgctaagagatggacaatgtgggagatgatgactgcacat
cttatccaaaatcatgagaacatcaagcgaggggaagatgataagttctcattggcattc
gcaaggattgaaaaccattattttgtgaataagggatttttaccctcagactcgcatctg
ttagacaatgttgacaagattcgacacattaaagcttttattgtacagggccggtatgat
gtttgctgtcctatgatgtctgcctgggatcttcataaagcatggcctgaagcagaattt
aagatggttccagatgcaggacactccgctaacgaggttggtgttgctgccgaactggta
tccgccaacgagaagctcaaaagcatgtttacaaaatga

DBGET integrated database retrieval system