KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339481
Entry
4339481           CDS       T01015                                 
Name
(RefSeq) lys-63-specific deubiquitinase BRCC36
  KO
K11864  BRCA1/BRCA2-containing complex subunit 3 [EC:3.4.19.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4339481
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4339481
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4339481
   03036 Chromosome and associated proteins [BR:osa03036]
    4339481
   03400 DNA repair and recombination proteins [BR:osa03400]
    4339481
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.-
     4339481
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M67
   4339481
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    4339481
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    4339481
   BRISC complex
    4339481
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    BRISC complex
     4339481
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     4339481
SSDB
Motif
Pfam: JAB BRCC36_C Prok-JAB UPF0172
Other DBs
NCBI-GeneID: 4339481
NCBI-ProteinID: XP_015640530
UniProt: B9FLE7 Q0DGB3
LinkDB
Position
5:26930553..26935799
AA seq 420 aa
MSLTEVRIGEEVWLTCLSHALTTETEEVMGLLFGDIKHSSRGGVTALIWGASPQMRCERK
KDRVEVNPELLAAATAQAESLSATIGEKTRVIGWYHSHPHITVLPSHVDVRTQAMFQLME
PGFVGLIFSCFSEDAQKVGKIQVIAFQSLGGNQQSVVPVNDPVINLESSWSSLDDTSHPA
LIEGIEQDTGDSKSSRNSKVWAKSSDVDFYPHFDANHSAKHQSKENAIVAYDPNNAPETP
VDLDESDMTPSIQEALHRSNMDISGAEYVRKEVPLYVFPTRHLLKLDTTLTSYCDMQHVV
FEEEKSAYNQAMHQNIRDGKIHPLTSIHHASTYNSSLCKLMEYCLSPAITVLQDRLKENE
LRLSMLMEEAKQLEAENQSMRNDSPRRLMYHGTSGTSSLMAQDKQMSPRSPSGTGRRKAS
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcgctgacggaggtcaggatcggggaggaggtgtggctcacctgcctctcccacgcc
ctcaccaccgagacggaggaggtcatgggcctcctcttcggcgacatcaagcattcgagc
aggggcggggtgactgctctgatatggggggcgtcgccgcagatgaggtgcgagcggaag
aaggacagggtggaggtcaaccccgagctgctcgcggcggcgacggcgcaggccgagagc
ttgtcggccaccatcggcgagaaaacgagggtgattggatggtaccactcgcacccgcat
atcaccgttctgccttcccatgtagatgttcggacccaggcaatgtttcagttgatggag
ccaggttttgtgggtctgatattctcttgttttagcgaagatgctcaaaaggttggaaaa
atccaagtgattgcttttcagtcacttggtggaaatcagcaatctgttgttcctgttaat
gatccagtcattaaccttgaatcatcttggagttcgttggatgatacctcacatccggca
ttgattgaaggcattgaacaagacacgggggattctaaatcttcaagaaatagcaaggtg
tgggcaaaatcttctgatgtggatttctatcctcattttgacgccaatcactcagcaaaa
catcaatccaaagaaaatgctatagttgcatacgatcccaataatgcacctgagacccct
gttgatctagatgaatcagatatgaccccaagcatccaggaggcgttgcacaggtcaaac
atggacattagtggtgcagaatatgtaagaaaggaggtgccactttatgtatttccgacc
aggcatctgctaaagctggacaccacattaacttcttactgtgatatgcaacatgtcgtt
ttcgaagaggaaaaatcagcatataatcaagccatgcatcaaaatattcgtgatgggaag
atccacccacttacatctattcaccatgcatctacatacaactcatctctctgcaaatta
atggaatattgtttgagccctgctataactgtacttcaggatcgtctgaaggaaaatgaa
cttcggttatctatgctaatggaggaggctaaacaacttgaggcagagaaccagagcatg
agaaatgattctcctcgtcgcttgatgtatcatgggactagtggcaccagttctctgatg
gcacaggataagcaaatgagccccagaagtcctagcggcaccggccggagaaaggcttcc
tga

DBGET integrated database retrieval system