KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339663
Entry
4339663           CDS       T01015                                 
Name
(RefSeq) protein SUPPRESSOR OF PHYA-105 1
  KO
K16240  protein suppressor of PHYA-105 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4339663
SSDB
Motif
Pfam: WD40 Pkinase ANAPC4_WD40 WD40_like PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 4339663
NCBI-ProteinID: XP_015639842
UniProt: A0A0P0WQP1
LinkDB
Position
5:complement(28445069..28452926)
AA seq 1144 aa
MAGTHGFRRVGVVEMEAATAAEVAGAGSGTDGDLQIKGSKENGQTAEQPAASEALEMPST
PLPLPRDIDWSEHFSFFNSVGGFGGSMDGARGLTSVGLSNSESRPDSVTQIQSCLNNADE
RVEELTLKNCISSDAQHEVSAGGSTSSGEKPTVMRGLWGNFTRMSWRASDVANREKLAAN
RGDVANLRVGDMPIRENLAVSFGNNMISRNDASNKEMGMSHGDHANNEFNLPFGNQQPFL
SPRPNQNEQRVERENALIVSSFSARILDQMRSKNVTPSSGVQSFPFKSVLKGKGVVYQGA
REEIQVQGNARTRAPMDKIRKIPNIPQDSMARMDGTIFGSGGNVLEPQCEGTSLRELIKP
ARQTMSKFEKMHFFKQILDLVDKSHAQGFSLQHLRPSYFTISASNQVKYIGSYGTQDLSA
PSKLDIATDDIFNTKRYLDPKVESQDSNGDNASITKYQKVGEQGSIAVRRPVHTFWANHR
GGNQSEGVDPGALWQGNSSCTVRERFKAAEPFYGGSMPYAQRPSSSGNQQSVFELRMLEE
SWYRSPEEISQLKGILPSNIYSLGVLLFELFCCCETWEVHCAAMSDLRHRILPPNFLSES
PKEAGFCLWLLHPDPCSRPKARDILGCDLINEGRDLSLLDNKTPVAVNEEDTESGLLLGF
LSQLKEEKEMHAAKLSADLASLETDIAEVEKRHSMRMGFSLEDMDVLAGSNDLSGASACA
LGGASLSGLPPSLCRSSIYEERVMRNLEQLENAYYSMRSTIDTSEANIIKRVDNDALRVR
QNFHELHSDANAIDEQADPLGWFFDGLCKYARYSRFEVRGILKNADILNSPNVICSLSFD
RDEEYFAAAGVSKKIKIFEFDALLNDRVDIHYPLIEMPSKSKLSCVCWNSYIKNYLASTD
YDGTVQLWDASSGQGFTQFTEHRKRAWSVSFSEVDPTKLASGSDDCCVKVWSINQKNCTD
TIRNVANVCCVQFSPYSSRMLAFGSADYKIYCYDLRNTRIPWCTISGHGKAVSYVRFLDP
ETLISASTDNTLKIWDLNQTNSSGLSTDACSMTLSGHTNEKNFVGLSVHDGYITCGSENN
EVFSYYKTFPMPITSHKFGSIDPITGQETNDDNQQFVSSVCWRGRSNMVVAANSTGSIKV
LELV
NT seq 3435 nt   +upstreamnt  +downstreamnt
atggcggggacgcatggttttcgtagggtaggcgtggtcgagatggaagcggcgacggcg
gctgaggtggccggtgccggcagcggcacggatggcgatttgcagattaaaggcagcaag
gagaatggtcagactgcggagcagccggcggccagcgaggcgcttgagatgccctccact
ccgctcccgctcccgagggacatagattggtcggagcatttctccttcttcaattcggtg
ggcgggtttgggggcagcatggatggcgcgaggggcttgactagtgttggcctatctaat
tctgagtcgaggccggatagtgtaacccagatccagagctgtttgaacaatgcagacgag
agggttgaggagctcacattgaaaaattgcatcagctccgatgcgcaacatgaggtttca
gctggtggaagcacgagcagcggggagaagcctacagttatgaggggtctgtggggtaat
tttacaaggatgtcatggagagctagcgacgtggctaacagggaaaaattagcagcgaat
cgtggtgacgttgcaaacttgagggtcggtgacatgcccatcagggaaaatttggcggtg
agcttcggcaacaatatgatctcacgaaatgatgcatccaacaaggaaatgggaatgagc
catggggatcatgcgaataacgagttcaatttgccgtttggtaatcagcagccttttctg
tctccacggcctaatcagaatgagcagcgagttgaaagggagaatgctctcatagtgagt
agcttttcagctagaattctggatcagatgaggagtaagaatgtaacaccttcgtctggg
gttcagagcttcccatttaagagtgtgttgaagggtaaaggtgttgtatatcaaggtgca
cgagaggagatccaagttcaaggtaatgcaaggaccagagcccctatggataagattcgc
aagatccctaacataccacaggattccatggctagaatggatggtacaatctttggcagt
ggtggaaatgttttagaaccacagtgcgagggaaccagcctaagggaactaattaagcct
gcacgccaaacaatgagcaagtttgagaaaatgcacttctttaagcagattcttgatctc
gtagacaaatctcatgcccagggttttagtttacagcatttgcgcccatcatactttact
atctcagcctcaaaccaagtaaaatatattggttcttatggtacccaagatttatcagcc
ccaagcaaactggatattgcgacggatgatattttcaatacaaaaagataccttgatccc
aaagttgagtcccaagattctaatggcgataatgcttcaatcacaaagtatcaaaaagtt
ggtgaacaaggatccattgctgtaaggcgaccagtgcataccttttgggctaatcacaga
gggggcaaccaaagtgaaggtgttgatcctggtgctttgtggcagggcaattcgagctgc
actgtccgagaacgttttaaggctgcagaacctttctatggtggcagtatgccctatgct
caacgaccatcaagttctggcaaccaacagtcagtatttgaattgaggatgctggaggaa
agctggtacagaagtccagaagagatcagtcagttgaaaggcatacttccatcaaacatc
tacagccttggggttcttttgtttgagctcttttgctgctgtgaaacatgggaggtacat
tgtgctgcaatgtcagatctccgtcatcgcattttgcccccaaattttctttcagaaagt
cctaaagaagctggtttctgtctttggttactccatccagatccctgttctcggcctaag
gcaagagatattctagggtgtgacttgataaatgagggtcgagatttgtccttgttagat
aataaaacaccagttgctgtcaatgaagaagacaccgaatctggtttgctactgggcttc
ctttctcaactcaaggaagaaaaggagatgcacgctgccaaattgtcagctgatcttgcg
agcttggaaacagatatcgcagaggttgagaaaagacactcaatgaggatgggatttagt
ttagaggacatggatgtactggcaggttctaatgatctctcaggagcttctgcatgtgcc
ctgggaggtgcatcactctcaggtttgccaccatctttgtgcagatcgagcatatatgag
gagcgggtcatgagaaacttggagcagcttgaaaatgcatattactccatgaggtccacc
attgacacatcggaggccaatataattaaacgagttgataatgatgctttaagggttcgt
caaaattttcacgagctgcatagtgatgctaatgctatcgatgagcaagcagaccccctt
ggatggtttttcgatggcttatgcaagtatgcccggtatagtaggtttgaagtacgggga
attctgaagaatgcagatatacttaactcaccaaatgtgatttgttcgttaagttttgat
cgggatgaagaatattttgctgctgctggtgtttcaaagaaaattaaaatatttgaattt
gatgcccttttaaatgatcgtgttgatattcattacccattgatagagatgcctagcaaa
tccaagcttagctgtgtctgttggaacagctacataaaaaattacttggcatcaacagac
tacgatggcactgttcagttgtgggatgcaagctcgggtcaaggattcacgcagtttacg
gagcaccgaaaaagagcttggtctgtaagtttctcagaggtggatccaactaaattggca
agtggaagtgatgattgctgcgtgaaagtttggagtattaaccagaaaaattgcactgat
accatcagaaacgtggccaacgtgtgctgtgtacagttctccccatactcctctcgtatg
ttagcttttggctcggctgattataagatatactgttatgatctgaggaatacaagaatc
ccatggtgtactatttctgggcatggaaaagctgtcagctatgtacgattcttggatcca
gaaacacttatctctgcatcaactgataacaccttgaaaatatgggatctcaaccagact
aattccagtggattatctactgatgcctgcagtatgacgttgagtggccataccaatgag
aagaattttgtggggttatctgttcacgatggatacataacttgtggttctgaaaataat
gaagtattttcttattacaaaacctttcccatgccaataacttctcacaagttcggttca
atcgacccaataactggacaagagacaaatgatgataaccaacaatttgtgtccagtgtt
tgctggcgagggaggtcgaacatggtagtggctgccaattctactggcagcattaaagtg
cttgagcttgtgtga

DBGET integrated database retrieval system