KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339815
Entry
4339815           CDS       T01015                                 
Name
(RefSeq) nucleoside diphosphate kinase 3
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
osa04016  MAPK signaling pathway - plant
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
osa_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
osa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4339815
   00240 Pyrimidine metabolism
    4339815
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4339815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339815
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4339815
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4339815
SSDB
Motif
Pfam: NDK PSI_PsaJ
Other DBs
NCBI-GeneID: 4339815
NCBI-ProteinID: XP_015639333
UniProt: Q5TKF4 A0A0P0WR33
LinkDB
Position
5:complement(29660576..29663526)
AA seq 239 aa
MSKLCQSACKAAKSLLSATAAASSPRTSLLAEGRNAALATLTNLGRKTLPTAYAYSYHHN
SSAAAAGWLAAIPAAVYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEILSRFERKGFKL
VAIKLVVPSKEFAQKHYHDLKDRPFFNGLCDFLSSGPVLAMVWEGEGVIKYGRKLIGATD
PQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKAEIGLWFEPRELVSYTSNEEKWIYGVN
NT seq 720 nt   +upstreamnt  +downstreamnt
atgagcaagctctgccagtcggcgtgcaaggccgccaagtctctcctctccgccaccgcc
gccgcctcctccccgcgcacctccctcctagccgaggggaggaacgcggcgctggccacc
ctcaccaacctggggaggaagaccctccccacagcttacgcctactcctaccaccacaac
tcctccgccgccgccgccggatggctcgctgccatccccgccgctgtttacatgctacag
gatcaggaggcgcatgctgcagagatggagcgcacctttatcgccatcaagcctgacggc
gtccaaaggggcctgatttctgagatactgtcccgatttgaaagaaaaggattcaagctt
gttgccatcaagctggtggttccatccaaagaatttgctcagaagcactatcatgatttg
aaagacagacctttcttcaatggattgtgtgacttccttagctctggccctgtgcttgcc
atggtttgggaaggagagggtgttatcaagtacgggagaaaactgattggtgctacagac
ccacagaagtctgaaccaggaaccatcaggggtgaccttgctgttgttgttggcaggaac
atcatccatggaagcgatggcccagagactgcaaaggctgagattggtctctggtttgag
cccagggagctggtctcttacaccagcaacgaagagaagtggatctacggggtcaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343275
Entry
4343275           CDS       T01015                                 
Name
(RefSeq) nucleoside diphosphate kinase 1
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
osa04016  MAPK signaling pathway - plant
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
osa_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
osa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4343275
   00240 Pyrimidine metabolism
    4343275
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4343275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4343275
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4343275
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4343275
SSDB
Motif
Pfam: NDK Mycobact_memb
Other DBs
NCBI-GeneID: 4343275
NCBI-ProteinID: XP_015647142
UniProt: Q07661
Structure
LinkDB
Position
7:complement(18335058..18337495)
AA seq 149 aa
MEQSFIMIKPDGVQRGLIGDIISRFEKKGFYLRGMKFMNVERSFAQQHYADLSDKPFFPG
LVEYIISGPVVAMVWEGKDVVATGRRIIGATRPWEAAPGTIRADYAVEVGRNVIHGSDSV
DNGKKEIALWFPEGLAEWRSNLHPWIYES
NT seq 450 nt   +upstreamnt  +downstreamnt
atggagcagtccttcatcatgatcaagcctgacggcgtccagagaggcctgattggagac
atcatcagcaggttcgagaagaaaggattctacctgagggggatgaagttcatgaatgtg
gagaggtcctttgcacagcagcactatgccgacctttccgacaagcccttcttccctggg
ttggtggagtacatcatctctggccccgtcgttgcgatggtttgggaagggaaggatgtt
gttgccactggccgcaggatcattggggccaccaggccctgggaggcagcccccggcacc
atccgtgctgactatgccgtggaagttggcaggaatgtcatccatgggagcgactccgtg
gacaacgggaagaaggagatcgctctctggttccctgaaggtttagctgagtggaggagc
aaccttcacccttggatctatgagtcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349403
Entry
4349403           CDS       T01015                                 
Name
(RefSeq) nucleoside diphosphate kinase 1
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
osa04016  MAPK signaling pathway - plant
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
osa_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
osa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4349403
   00240 Pyrimidine metabolism
    4349403
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4349403
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349403
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4349403
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4349403
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 4349403
NCBI-ProteinID: XP_015614147
UniProt: A3C7D3 Q7XC37
LinkDB
Position
10:complement(22257990..22260457)
AA seq 151 aa
MALEQTFIMIKPDGVQRGLIGEVIGRFEKKGFYLKAMKLINVEKSFAEKHYADLSSKPFF
GGLVEYIVSGPVVAMVWEGKQVVSTGRKLVGATNPLAAEPGTIRGDFAVDIGRNVIHGSD
SVENARKEIALWFPEGIAEWRSNQHPWIYEV
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcgttggagcagaccttcatcatgatcaagcccgacggcgtccagaggggcctcatt
ggcgaggtcatcggccgcttcgagaagaagggattctacctcaaagccatgaagctcatc
aacgtggagaagtcgttcgccgagaagcactacgccgatctgtcctccaagcccttcttc
ggagggctcgtggagtacatcgtctccggccccgtcgtcgccatggtctgggagggcaag
caggtcgtctccaccggccgcaagctcgtcggggccaccaaccccctggccgctgagccg
ggcaccatccgtggcgacttcgctgtcgacattggcaggaatgtcatccacggaagcgac
tcggtcgagaacgccaggaaggagattgctctgtggttccctgagggcatcgccgagtgg
aggagcaaccagcacccatggatctatgaggtctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352460
Entry
4352460           CDS       T01015                                 
Name
(RefSeq) nucleoside diphosphate kinase 2, chloroplastic
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
osa04016  MAPK signaling pathway - plant
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
osa_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
osa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4352460
   00240 Pyrimidine metabolism
    4352460
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4352460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4352460
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4352460
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4352460
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 4352460
NCBI-ProteinID: XP_015618263
UniProt: Q0IMS5 A0A0N7KU64
LinkDB
Position
12:22182878..22189398
AA seq 220 aa
MDAMAVLARTSRPAPTLLAATSPAVSRRPAAVSFAAAASPGSRGRVALSAAWGGRAARGR
VSAAGRIVASSVEQSYIMIKPDGVQRGLVGEIISRFEKKGFVLKGLKLFQCPKDLAQEHY
KDLKEKPFFPGLIEYITSGPVVCMAWEGNGVVASARKLIGATNPLQAEPGTIRGDLAVQT
GRNVVHGSDSPDNGKREIALWFKEGELCEWESVLTPWLVE
NT seq 663 nt   +upstreamnt  +downstreamnt
atggacgccatggccgtgctcgcgaggacctcccgccccgccccgaccctcctcgccgcg
acctcccccgcggtgtcccggcgcccggcggccgtctccttcgccgccgccgcctccccg
gggtcccgcggccgcgtcgcgctgagcgccgcgtggggcgggagggcggccagggggcgc
gtctccgccgccggccgcatcgtcgcgtcgtcggttgagcaatcctatattatgatcaag
cctgatggtgttcagcgaggcctggttggcgagattatttcccgtttcgagaagaaaggc
tttgtgttgaagggcttaaagctttttcagtgccccaaggacttggcacaggagcactac
aaggatttgaaggaaaaacctttctttcccggtctgatcgagtacataacttctggccct
gttgtttgcatggcttgggaggggaatggtgttgttgcatcagctcgcaagttaatagga
gctactaatccccttcaagctgaaccagggaccatacggggcgatcttgcagttcaaaca
ggaaggaatgttgtccatggaagtgacagtcctgataacggcaagcgtgaaatcgctcta
tggttcaaagaaggcgaactctgcgaatgggaatctgttctgacaccatggcttgtagag
taa

DBGET integrated database retrieval system