KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339898
Entry
4339898           CDS       T01015                                 
Name
(RefSeq) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 2
  KO
K01244  5'-methylthioadenosine nucleosidase [EC:3.2.2.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4339898
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.16  methylthioadenosine nucleosidase
     4339898
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-GeneID: 4339898
NCBI-ProteinID: XP_015643737
UniProt: A3B7P5 Q9LHZ0
LinkDB
Position
6:692716..695691
AA seq 259 aa
MAPPSDSDDSAPIPAGAISKLLIVIAMQTEALPLVNKFHLVEAEESIFPKGAPWIRYHGN
YKGLHVDLVWPGKDPVLGVDCVGTVSAALVTYASIQSLKPDLIINAGTAGGFKAKGADIG
DVYLASDVAFHDRRIPIPVFDMYGIGTRKTFATPNILKELNLKVGKLSTGDSLDMSPHDE
SAILNNDATVKDMEGAAVAYVADMFSTPAIFVKAVTDIVDGEKPTAEEFLQNLVAVTAAL
DKAVTEVVDFISGKCISDL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggccccgccctccgactccgacgactcggccccgatccccgccggcgccatctccaag
ctcctcatcgtcatagcgatgcagacggaggcgctcccgctcgtcaacaagttccacctc
gtcgaggcggaggaatccatatttcctaaaggtgccccatggattagataccatggcaac
tacaaaggccttcacgttgaccttgtatggcctggaaaagatcctgttctcggagttgac
tgtgttggcacggtatcagcagcacttgtgacttatgcttctattcagtcattgaagcca
gatctgatcatcaatgctggcactgctggtgggtttaaggccaaaggagcagacattgga
gatgtctacttagcatccgatgttgcattccacgataggagaatacctatccctgtcttc
gacatgtatggaattggaacacgaaaaacatttgctacccctaatatattgaaggaactc
aatttgaaggttgggaagctctcaactggcgattctctagatatgtctccccatgacgag
tcagcaatattgaacaatgatgctacagtcaaggatatggagggagccgcggtggcatat
gttgctgacatgttttcaacaccggcaatctttgtgaaagctgtgactgatattgttgat
ggggagaaaccaacagccgaggagtttctgcagaacctggttgctgtgacagcagctctg
gacaaggcagttacagaagtggttgatttcatcagtgggaaatgcatatcggatctttga

DBGET integrated database retrieval system