KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339929
Entry
4339929           CDS       T01015                                 
Name
(RefSeq) syntaxin-43
  KO
K08489  syntaxin 16
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4339929
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339929
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-TGN / EE
    4339929
SSDB
Motif
Pfam: SNARE GCP_C_terminal EF-G-binding_N K_channel_TID MCPsignal Syntaxin_2 Prominin
Other DBs
NCBI-GeneID: 4339929
NCBI-ProteinID: XP_015641289
UniProt: B9FR77 Q5VRL4
LinkDB
Position
6:complement(902521..907090)
AA seq 330 aa
MATRNRTPLYRKYRDALRHVRAPAGAPSSSSSGGGGGGGGGGPVIEMASLLRSNRPYAPL
STDDPSAASSRSAVTVGLPPAWVDVSEEISANMQRARTKMAELAKAHAKALMPSFGDGRD
DQRAIEILTHEVTDLLKRSEKRLQKLSMKDSSEDSNVRKNVQRSLATDLQSLSMEFRKKQ
STYLKQLRQQKEGQDGVDLEMNMNGSKSTFELGDDEFEDVGFTEVQMSKLKKSEAFTRER
EREIEQVVESVNELAQIMKDLSVLVIDQGTIIDRIDYNIQNVAASVEEGYKQLQKAERTQ
KKGGMVMCATTLVILIFIMIVLLILKKILF
NT seq 993 nt   +upstreamnt  +downstreamnt
atggcgacgcggaaccggacgcctctgtaccgcaagtaccgcgacgcgctgcgccacgtc
cgcgcgccggcgggggctccgtcgtcgtcatcgtccggaggaggaggaggaggaggaggc
ggggggccggtgatcgagatggcctcgctgctgcgctccaaccgcccctacgcccccctc
agcaccgacgacccctccgccgcctccagtagaagtgctgtgacggtcgggctgcccccg
gcatgggttgatgtttccgaagagatatctgccaacatgcagcgggcaagaacgaagatg
gcagagctggctaaggcacatgccaaagccttgatgccatcctttggtgatggtagagat
gaccagcgagcaattgagattcttacacatgaggtaacagacttactgaagaggtcggag
aagagacttcagaagctatccatgaaagattcttcagaggattcaaatgtccgaaagaat
gtccagcgttcactcgctacagacctgcaaagcctttcgatggagttccgtaaaaaacag
tcaacttatttaaagcagctacgccaacagaaagaggggcaagatggagttgatttggaa
atgaacatgaatggttctaagtcgacatttgaacttggagatgatgaatttgaggatgtg
ggtttcacggaggttcagatgtcaaaacttaagaaaagcgaagcattcaccagagaaaga
gaaagagaaatcgagcaggttgtcgaatcagttaacgagcttgcacagatcatgaaggac
ctttcagttcttgtgatagatcagggaactatcatagatcggatagactacaatatacag
aatgttgcagcttccgttgaagagggttataaacaattgcaaaaggctgagaggacacag
aagaaagggggcatggtcatgtgtgcgactacccttgtcattcttatcttcatcatgata
gtcctcctgattttaaagaagatccttttctga

DBGET integrated database retrieval system