KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339996
Entry
4339996           CDS       T01015                                 
Name
(RefSeq) nudix hydrolase 14, chloroplastic
  KO
K18447  ADP-sugar diphosphatase [EC:3.6.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00230  Purine metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4339996
   00500 Starch and sucrose metabolism
    4339996
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4339996
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.21  ADP-sugar diphosphatase
     4339996
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 4339996
NCBI-ProteinID: XP_015641722
UniProt: Q9SNS9 A0A0P0WSD5
LinkDB
Position
6:complement(1574538..1577199)
AA seq 325 aa
MAAAAARQCLLGFRRAAPPPLPLLSTRAPSPAPSSRRGARMASSGDHAPQLSTAVAVPGA
GAPVRVVAAPGLTEADFTSAVESSLFRQWLKNLQEEKGVLTYGRLNLRQILIQGVDMFGK
RVGFVKFKADIIDEETKAKIPGIVFARGPAVAVLILLESKGQTYAVLTEQVRVPVGKFIL
ELPAGMLDDEKGDFVGTAVREVEEETGIKLNLEDMIDLTALLNPDTGCRMLPSPGGCDEE
IGLFLYRGHADEDTLRALQGKETGLRDHGELIKLRVVPYSQLWRATADAKALSAIALYEM
AKREGLLPSSPTTSRRRGSSSSANL
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgcgtcagtgtctgcttggattccgacgagcagcgccgccgcct
ctcccgctcctgagcacgcgcgctccctctcccgctccgtccagccgccgcggcgcgcgc
atggcctcgtccggcgaccacgcgccgcagctcagcaccgccgtcgcggtgcccggcgcg
ggcgcgcccgtccgcgtcgtggccgcgccgggcctcaccgaggcggatttcacgagcgcg
gtggaatcctcgctgttcaggcagtggctgaagaacctgcaggaggagaagggggtcctc
acctacgggaggctgaacctgaggcaaatcctcatccagggggttgacatgtttgggaaa
cgcgtggggtttgtcaagttcaaggctgacatcatcgacgaggagaccaaagccaagatt
ccaggaattgtatttgcaagagggcctgctgttgctgtgttgattcttttggagtctaaa
gggcaaacttacgctgttcttacagaacaggttagagttcctgttggaaaatttatattg
gaactacctgctgggatgctagacgatgaaaagggagattttgttggcactgcagtccgt
gaggttgaagaagaaactggaattaagctaaatttagaggatatgattgaccttactgca
ttgctgaaccctgacactggatgcagaatgcttccttcaccgggtggctgcgacgaagag
attgggctgttcctgtacagaggccacgccgacgaggacacccttagggctctccaaggg
aaggagactgggctgcgcgaccatggcgagctgatcaagctgcgggtggtgccgtacagc
cagctgtggcgcgccaccgccgacgccaaggcgctcagcgccatcgccctgtacgagatg
gccaagagggaaggcctcctgccgtcgtctccgacgacctctcgccgccgtggcagctcg
tcgtcggccaacttgtaa

DBGET integrated database retrieval system