KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340026
Entry
4340026           CDS       T01015                                 
Name
(RefSeq) 3-phosphoshikimate 1-carboxyvinyltransferase 2
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4340026
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     4340026
SSDB
Motif
Pfam: EPSP_synthase
Other DBs
NCBI-GeneID: 4340026
NCBI-ProteinID: XP_015643046
UniProt: Q5VNW0
LinkDB
Position
6:1816184..1819788
AA seq 515 aa
MAATMASNAAAAAAVSLDQAVAASAAFSSRKQLRLPAAARGGMRVRVRARGRREAVVVAS
ASSSSVAAPAAKAEEIVLQPIREISGAVQLPGSKSLSNRILLLSALSEGTTVVDNLLNSE
DVHYMLEALKALGLSVEADKVAKRAVVVGCGGKFPVEKDAKEEVQLFLGNAGTAMRPLTA
AVTAAGGNATYVLDGVPRMRERPIGDLVVGLKQLGADVDCFLGTECPPVRVKGIGGLPGG
KVKLSGSISSQYLSALLMAAPLALGDVEIEIIDKLISIPYVEMTLRLMERFGVKAEHSDS
WDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQGCGTTSLQGDVKFAEV
LEMMGAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVAMTLAVVALFADGPTAI
RDVASWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLNITAIDTYDDHRMAMAF
SLAACADVPVTIRDPGCTRKTFPNYFDVLSTFVRN
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcggcgaccatggcgtccaacgccgcggctgcggcggcggtgtccctggaccaggcc
gtggcggcgtcggcggcgttctcgtcgcggaagcagctgcggctgcccgccgcggcgcgc
ggggggatgcgggtgcgggtgcgggcgcgggggcggcgggaggcggtggtggtggcgtcc
gcgtcgtcgtcgtcggtggcagcgccggcggcgaaggcggaggagatcgtgctccagccc
atcagggagatctccggggcggttcagctgccagggtccaagtcgctctccaacaggatc
ctcctcctctccgccctctccgagggcacaacagtggtggacaacttgctgaacagtgag
gatgttcactacatgcttgaggccctgaaagccctcgggctctctgtggaagcagataaa
gttgcaaaaagagctgtagtcgttggctgtggtggcaagtttcctgttgagaaggatgcg
aaagaggaagtgcaactcttcttggggaacgctggaactgcaatgcgaccattgacagca
gccgtgactgctgctggtggaaatgcaacttatgtgcttgatggagtgccacgaatgagg
gagagaccgattggtgacttggttgtcgggttgaaacaacttggtgcggatgtcgactgt
ttccttggcactgaatgcccacctgttcgtgtcaagggaattggaggacttcctggtggc
aaggttaagctctctggttccatcagcagtcagtacttgagtgccttgctgatggctgct
cctttggcccttggggatgtggagatcgaaatcattgacaaactaatctccattccttac
gttgaaatgacattgagattgatggagcgttttggtgtgaaggcagagcattctgatagt
tgggacagattctatattaagggagggcagaagtacaaatctcctggaaatgcctatgtt
gaaggtgatgcctcaagcgcgagctatttcttggctggtgctgcaatcactggaggcact
gtgacagttcaaggttgtggtacgaccagtttgcagggtgatgtcaaatttgctgaggta
cttgagatgatgggagcaaaggttacatggactgacaccagtgtaaccgtaactggtcca
ccacgtgagccttatgggaagaaacacctgaaagctgttgatgtcaacatgaacaaaatg
cctgatgttgccatgacccttgccgttgttgcactcttcgctgatggtccaactgctatc
agagatgtggcttcctggagagtaaaggaaaccgaaaggatggttgcaattcggaccgag
ctaacaaagctgggagcatcggttgaagaaggtcctgactactgcatcatcaccccaccg
gagaagctgaacatcacggcaatcgacacctacgatgatcacaggatggccatggccttc
tccctcgctgcctgcgccgacgtgcccgtgacgatcagggaccctggttgcacccgcaag
accttccccaactacttcgacgttctaagcactttcgtcaggaactga

DBGET integrated database retrieval system