KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340043
Entry
4340043           CDS       T01015                                 
Name
(RefSeq) WASH complex subunit 7 isoform X1
  KO
K18465  WASH complex subunit 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4340043
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4340043
Membrane trafficking [BR:osa04131]
 Protein recycling
  Others
   WASH complex
    4340043
SSDB
Motif
Pfam: WASH-7_mid WASH-4_N WASH-7_C
Other DBs
NCBI-GeneID: 4340043
NCBI-ProteinID: XP_015644367
LinkDB
Position
6:1937793..1948933
AA seq 1158 aa
MASLLLEQQEKLRRHVDEWRFRCRAAVAEIGPRSASTSVSSASVRLRVAPTDPGVGVGAA
SLLTAAAAAEDNVDVSKFVAVLSHSCLEISRLSDAASSNLYRQLLLFGHTAEGPNEALLE
GEPQKTFAHSIPLLLEVYEIINGLVMILGNLLRQLDAICSVRDKNVRPLNSFKGLDLTTV
FGSLGEGLMVFLLVDEILRHNGNTRSYLSLFSRMLDKVKSEVDVFSMSFEDVDFLDQVVH
NLQKLFDIGFFQRLVQEDSPLCSSITLVRSNKKLLDTFYSFFSESSSEIIQRIGSLKELP
IDRRTILHLLGLFLFFTTTTGEAPDKKSMNLLVEIFQLVPVVYVEGGKRIVLSDLIRFHC
SPSLSLLPPIKEACEAFGIMKNSYLARLNEMHSRDIQAINDSLSCWSVSFQSAIHPSSQM
LTEEWVRHLQKQILQGVVLADRIHMLVLSMLDLHMHLEVPLRREKAKSLCQMIVSLKAIG
DLFHMKGSSLVRSLPHIINIIQSDIEQLIISLKTKLQNEIAKGSQAVKTGFLSSLIRGGT
DTETRLIDSLSLVLMSLQLLEGGGSSQRQLTLSITMDILHSLGYLDIELVGVRKLISKFS
ILSNFWSLIDERTNCSFLYWRKEMLVTWLSMVYGDACKLSWLQNIIDAFSDGMSLLTLGN
VGTVTLQHYEEEIENALRKEVVAPLCRDIETDLRLHVHSTHLKGSVFVNPTKTGVRNLSW
YLRMKPLRLPSKFVDIKFLVENHLNSAFYTYSVMSNYDNRMYAEMHQLGELKYGVELEDF
HLTVDTADQDFDLKQSMENLDSFSEAYSYNIVKQMFIENDLGGQGRKNLRVLCVDHIASS
AAMCNLQRISAYIDSIFVFLNRMFVDLHALLQSNIEIDLLRDFKQSENTGVSDAHPATQG
DMKFALGKLGLGDHALDLLEQVQAAVTRIGSVLGLMMVLTAGRTRYLNNMSRYVRKPKFD
LRYTTSCKLLGWDDDIVEISKVLDMGTRNNDPSDDRIQPFSILATNFSKKLQSNKLHEMK
DFFQIVPSVIAHMMECRLLLKDKLLRRGHEDKRYTHTYDGFLLGVAFVLKVLEQDNSFDE
LNWFASTKAKLEGEAKDRDDKKTDRNTSGASFVSLKLWRSSPPVRTEQQKGGVDKGTRYM
QEIELIECLFRLARTVLR
NT seq 3477 nt   +upstreamnt  +downstreamnt
atggcgtcactcttactcgagcagcaggagaagctgcggcggcacgtcgacgagtggcgg
ttccggtgccgcgcggccgtcgccgagatcgggccccgctccgcgtccacctcggtgtcc
tccgcctcggtcaggctccgggtggcccccaccgaccccggcgtcggtgtgggcgccgcg
tccctcttgaccgccgcggcggcggccgaggacaacgtcgacgtctccaagttcgttgcc
gtgctctcccactcgtgccttgagatatcccgcctctctgatgctgcgtcaagtaatctc
tatcggcaactgctcctctttgggcacactgcagagggaccaaatgaggcacttctggag
ggggagccacaaaagacatttgcacactcaattccattgttacttgaggtgtatgaaatc
atcaatgggctggtgatgatccttgggaacctgctccggcagctggacgcaatctgctca
gtccgtgacaagaatgtgcgtccattgaactcatttaagggtttagatttgacaaccgta
tttggatcacttggcgaggggcttatggtgttccttttggtagatgaaattttgaggcac
aatggcaataccaggagttacctatctctattctcaaggatgctggacaaggtgaaatct
gaggtcgatgtatttagtatgtcattcgaggatgtagatttccttgatcaagttgtacac
aacttacagaaactttttgacattggcttcttccaacggttggtgcaagaagattcacct
ttgtgctcttcaataaccctcgttagatctaataagaaactgttagacacattttattct
ttcttctctgagagcagttctgagatcattcaacgcatcggttctttgaaggaactcccc
attgatcgaaggactatactccatcttctaggcctttttttgttcttcacaacgacaact
ggtgaagctcctgataagaaatcaatgaacctgttagtggagatatttcagttggttcca
gtggtctatgttgaaggtggaaagcgtattgtgctatctgacttaattaggtttcattgc
tctccatcactttctttgttgccacccattaaggaagcttgtgaagcttttggtatcatg
aagaatagctatctggcacggttaaatgaaatgcattcaagggatattcaagccataaat
gattcgttatcatgctggtctgtttcattccagtcagccattcatccatcgtcgcagatg
ctgactgaagagtgggttcgacatctccagaaacaaattttgcagggagtagtgcttgca
gatagaatacatatgcttgtcctatcaatgcttgacttgcatatgcatcttgaggttcca
ctgagaagggagaaagccaagtctctttgccaaatgattgtgtcattgaaggccatagga
gacttgttccacatgaaagggtctagcttagtgcgcagtcttcctcacataatcaacatc
attcaatctgatattgaacaactcataatatcattgaagactaaattacaaaatgaaata
gccaaggggagtcaggcagtcaagacaggatttcttagttcattgatacgtggtggtaca
gacacggagacaaggcttattgattcactttcgttggttctgatgtccttgcaattgctt
gaaggaggtgggagttctcagaggcaactgacactttctattacaatggatattctgcac
agtctgggttacttggatattgagttggttggtgtgagaaagcttatatcgaagttcagc
attctttcgaatttctggtctctgattgatgaaaggacgaactgcagctttttgtattgg
agaaaagagatgcttgtgacttggttatcaatggtatatggagatgcctgcaaattatct
tggctacagaacatcattgatgcattttctgatggaatgtcacttcttacacttgggaat
gtgggaactgttactcttcagcactatgaggaagaaattgagaatgctctgcgaaaggag
gttgttgccccactgtgtagagatattgagacagacctccgactccatgttcattccact
cacttaaaaggatcagtctttgtgaacccaacaaagactggggttcgtaatctttcgtgg
tacttaagaatgaagcccttgagactaccttccaagtttgttgatattaaatttcttgtg
gagaaccatctaaattctgcgttctatacttactcagtgatgtctaactatgacaacagg
atgtatgcagagatgcatcaactaggagagctgaaatatggtgttgaactggaagatttc
catcttactgtggataccgcggatcaagattttgatctaaaacaatccatggaaaatctt
gattcatttagtgaggcatattcctacaacattgtcaagcagatgtttattgagaatgat
ctgggtggccaaggccgaaaaaacttgagagttttatgtgtggatcatattgcatcttca
gctgccatgtgcaatttacagcgaatttctgcatatatagattccatttttgttttctta
aaccggatgtttgtagatcttcatgctttgcttcaaagcaacattgaaattgatttatta
agggatttcaaacaatcagagaacactggagtgtccgatgcccatcctgctacccaagga
gacatgaaatttgccctaggaaagcttgggcttggagaccatgctctagacttgcttgaa
caagtacaagctgctgttactagaataggtagcgtactaggtctcatgatggtacttacg
gctggccgcacccgttatttgaacaacatgtcacgatatgtgagaaaacccaaatttgac
ttgagatacacgacaagttgcaagctgctggggtgggatgatgacattgttgaaattagt
aaagttttggacatgggcacaagaaacaatgatccatcagacgatagaattcagccattt
tcaatattagcaaccaacttttcaaagaagctccagagcaataaacttcacgaaatgaag
gatttctttcaaattgttccatccgtaattgcccacatgatggaatgtagacttcttctc
aaggataaattattaagacgggggcatgaagacaagagatacacacatacttacgatggt
ttcctacttggagttgcttttgtcctcaaggttttggagcaagataactcatttgatgaa
ctcaattggttcgcttccacaaaagcaaaattggaaggagaggcaaaggacagggacgac
aagaaaaccgatagaaacacgagcggagctagctttgtcagtctgaaactctggcgctca
agtccacctgttaggacagagcagcaaaagggtggtgttgacaaggggacgcgctacatg
caggaaattgagcttatagaatgtctattcaggcttgctagaacagtattgagatga

DBGET integrated database retrieval system