KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340050
Entry
4340050           CDS       T01015                                 
Name
(RefSeq) GDP-mannose 4,6 dehydratase 1
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4340050
   00520 Amino sugar and nucleotide sugar metabolism
    4340050
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     4340050
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2
Other DBs
NCBI-GeneID: 4340050
NCBI-ProteinID: XP_015642876
LinkDB
Position
6:2016882..2019347
AA seq 450 aa
MGTDTCFAGSCCKMASYSKESLSIYEFLLYFFEVEGPTAGGPYKYSLPSLPTLPLKFPPR
LASPRPPPTRSKQVEMATTQHSNGGAAGDNGEAAPPSVPPSLAPPRKVALVTGITGQDGS
YLTELLLGKGYEVHGLIRRSSNFNTQRLDHIYHDPHSQPSTPRPPMRLHYADLSDSSSLR
RALDHILPDEVYNLAAQSHVAVSFEVPDYTADVTATGALRLLEAVRLASKRIRYYQAGSS
EMFGSTPPPQSESSPFHPRSPYAAAKVAAHWYTVNYREAYGLFACNGVLFNHESPRRGEN
FVTRKITRAVGRIKVGLQTKVFLGNLSAARDWGFAGDYVEAMWRMLQQDKPGDYVVATEE
SHTVEEFLQAAFGYAGLNWKDHVVIDKKYFRPAEVDSLQGDATKARKELGWKPKVGFQQL
VEMMVDNDIELAKKEKVLVDAGYRDPKQQP
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgggcaccgacacttgttttgcaggatcgtgctgtaaaatggcatcgtactcaaaggaa
tcactctcaatctatgagttcctcctctatttttttgaggtagagggtcccactgcaggc
gggccctacaaatactccctgccctcgttgcccactcttcccctcaaatttcctcctcgc
ctcgcctcgcctcgtcccccacccaccagatctaagcaggttgaaatggccacgacgcag
cactccaacggcggcgccgccggcgacaacggcgaggccgcgccgccgtcggttccgccc
tccctcgcgccgccgcggaaggtggccctggtgacgggcatcacggggcaggacgggagc
tacctgacggagctgctcctcggcaagggctacgaggtgcacggcctcatccgccgctcc
tccaacttcaacacccagcgcctcgaccatatctaccacgacccgcactcccagccgtcg
acgccgcgccccccgatgcgcctccactacgctgacctctccgactcctcctccctccgc
cgcgcgctcgaccacatcctccccgacgaggtctacaacctcgccgcccagtcccacgtc
gccgtctccttcgaggtccccgactacaccgccgacgtcaccgccaccggcgcgctccgc
ctcctcgaggccgtgcgcctcgccagcaagcgcatccgctactaccaggcggggtcctcc
gagatgttcggctccacgccgccgccgcagagcgagtcctcccccttccacccgcgctcc
ccctacgccgccgccaaggtcgccgcccactggtacaccgtcaactaccgcgaggcctac
ggcctcttcgcctgcaacggcgtgctcttcaaccacgaatccccacgccgcggcgagaac
ttcgtcacccgcaagatcacccgcgccgtcggccgaatcaaggtcgggctccagaccaag
gtcttcctcggcaacctctccgccgccagggactggggattcgccggggactacgtcgag
gcaatgtggcgcatgctgcagcaggacaagcccggcgactacgtcgtcgccaccgaggag
tcccacaccgtcgaggagttcctccaggccgccttcggctatgcagggctcaactggaag
gatcatgtagtcattgacaagaagtacttccgccccgccgaggtggacagcctccagggg
gatgcaaccaaggccaggaaggagcttgggtggaagcccaaggtcgggttccagcagctc
gtcgagatgatggttgataacgacattgagcttgccaagaaggagaaggtcctcgtcgat
gccgggtaccgtgatcccaagcagcagccatag

DBGET integrated database retrieval system