KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340098
Entry
4340098           CDS       T01015                                 
Name
(RefSeq) DNA-repair protein XRCC1
  KO
K10803  DNA-repair protein XRCC1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4340098
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4340098
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     4340098
SSDB
Motif
Pfam: BRCT PTCB-BRCT BRCT_2
Other DBs
NCBI-GeneID: 4340098
NCBI-ProteinID: XP_015641642
UniProt: Q0DEM9 Q5VQ75
LinkDB
Position
6:2329840..2334446
AA seq 347 aa
MPESSSDPNNGRGKSSKRNLPSWMGSKDGEENPGKKKHMATHEKVQKGSDFSKLLDGVVF
VLSGFVNPERGTLRSQALDMGAEYRPDWTSDCTLLVCAFANTPKFRQVESNNGTIVSKDW
ILESHSQRKLVDIEPYLMHVGKPWRKNKELVESDEDQKKPHKEHQKQVDRSHIKTSPSAG
IEAKHSDVTSKQFSPTKIKQWAKNDLAQTISWLESQEEKPEPNELKAIAAEGVITCLQDA
IESLKQGNDVKGVAEQWSFVPHVINELAELDGRRKEGSLSKEQLSQLAIKCKKIYQAEFA
HMHDNDKKHQSKPRSDDAQYDSDDTIEMTEEEIDLACRQLPGVCGRQ
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgcctgaatcgagctcagatcctaacaacgggagaggaaagtcatccaagaggaatctc
ccttcttggatgggttcgaaagacggggaggaaaatccaggcaagaagaagcacatggcc
acccacgagaaggtgcagaaaggatcggatttctccaaacttttggatggggtggtcttt
gtactttcagggtttgtgaaccctgaaagaggcacattgcgctcccaagcattggatatg
ggagccgagtatcgacccgattggacatcagattgcacacttctcgtttgtgcatttgcc
aatacccccaagtttcgacaagtcgaatcgaacaatggaaccattgtctcgaaggactgg
atcttagaatctcacagccaaagaaaacttgttgatattgagccttaccttatgcatgtt
ggaaaaccgtggagaaaaaataaagagctagttgaatctgacgaagatcagaagaagcca
cataaagagcatcagaagcaagttgatcgatctcatatcaagacatctccctctgcaggc
atagaggcaaaacattcagatgttactagtaagcaattttctccaacaaaaataaaacaa
tgggcaaagaatgatttagcacagacaatatcatggttagagagccaagaagagaagcca
gaaccaaatgagttgaaggcaatagctgctgaaggggttatcacttgtttgcaagatgcc
atagaatctctcaagcaagggaatgatgtcaagggagtggcggagcagtggagctttgtc
ccccatgtcatcaatgaactggcggaacttgatggaagaagaaaagagggatcgttatcg
aaagaacaactctcccagctagcaatcaaatgcaaaaagatttatcaggctgagtttgcc
cacatgcatgataatgacaagaagcatcagagcaagcctagatcagatgatgctcagtat
gacagtgatgacaccatcgaaatgacggaagaagagattgatctcgcatgcaggcaactc
cctggggtatgcgggaggcagtag

DBGET integrated database retrieval system