KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340157
Entry
4340157           CDS       T01015                                 
Name
(RefSeq) ubiquinone biosynthesis O-methyltransferase, mitochondrial
  KO
K00591  polyprenyldihydroxybenzoate methyltransferase / 3-demethylubiquinol 3-O-methyltransferase [EC:2.1.1.114 2.1.1.64]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4340157
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     4340157
    2.1.1.114  polyprenyldihydroxybenzoate methyltransferase
     4340157
SSDB
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 CMAS PrmA MTS Ubie_methyltran Methyltransf_9 NodS Methyltransf_32 TehB GidB MetW
Other DBs
NCBI-GeneID: 4340157
NCBI-ProteinID: XP_015641346
UniProt: A0A0N7KLJ6 Q0DEH4
LinkDB
Position
6:2699898..2705115
AA seq 327 aa
MLRRVAPSLRRAILTSSAHGRAGAQLTEPGLSPRHALLPQWRLCSSAASTNSPPPPPPPP
SSPPQGTPRPAGGSTVSSLNPAEVAKFAAIAETWWDSEGPFKPLHLMNPTRLSFIRSTLC
RHFRRDPNSSKPLEGLKVIDVGCGGGILSEPLARMGATVTGIDAVDKNIKIARVHAASDP
STASIEYFCTTAEDLVKENKQFDAVISLEVIEHVANPSGFCESLSALTVPNGATVISTIN
RSMRAYATAIVAAEYILNWLPKGTHQWSKLVTPEELVLILERASISVQEMAGFVYNPLRG
EWSLSDDLTVNYIAYGMKKVETPSESN
NT seq 984 nt   +upstreamnt  +downstreamnt
atgctccgccgcgtcgcgccatccctgcggcgagctatcctcacatcctccgcccatggc
cgcgcgggcgcgcaactcacggagcctggtctctcgcctcgccacgctctgctcccgcaa
tggcgcctttgctcctccgcggcctccacgaactctcccccgcccccgccgccgcctcct
tcttctccgcctcagggaacaccgcgtccagcaggcggatccaccgtctcgtcgctgaac
cctgccgaggtcgccaagttcgccgccatcgctgagacctggtgggattctgaaggtcca
ttcaagccgttgcatctgatgaatccaactcgactgtcttttatccggtccactctctgt
agacatttcaggcgggatccaaattcttctaaaccacttgaaggccttaaagttattgat
gttggatgtgggggtggcattctctcagagcctcttgctcggatgggagctacagttact
ggaattgatgctgttgacaaaaatataaagattgcacgtgtccatgctgcatccgatcca
tcaactgcttccatagaatatttctgcacaacagctgaggatttggtgaaagagaacaaa
caatttgatgctgtgatttctcttgaggtgatcgagcatgtggctaatccctcggggttc
tgtgaatctttgtcagctttgacagttcctaatggggccactgtgatttctacaatcaac
cgctcaatgagggcatatgcaactgcaatagtcgctgcggagtatattcttaattggctt
cctaaaggcacacatcagtggtccaaactagttacccctgaggagctggtccttatactg
gaaagagcttcaatctctgtacaagaaatggccgggtttgtgtataatccgctgcgtgga
gagtggtctctgtcagatgatcttactgtaaattatattgcttatggcatgaagaaagtc
gaaacaccctctgagtcaaattga

DBGET integrated database retrieval system