KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340227
Entry
4340227           CDS       T01015                                 
Name
(RefSeq) E4 SUMO-protein ligase PIAL1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4340227
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4340227
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4340227
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   4340227
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    4340227
SSDB
Motif
Pfam: zf-MIZ zf-Nse zf-Sec23_Sec24 zf-C3HC4_2
Other DBs
NCBI-GeneID: 4340227
NCBI-ProteinID: XP_015643308
UniProt: B9FRP0 Q5VRS8
LinkDB
Position
6:complement(3250475..3261420)
AA seq 872 aa
MASAAPLPPTPPPSQQQQPQPQGKEQQQQMAVAMNARRLVMIGDRLRTHFRGGGGTVLEP
PDLAHLVYAFARGIDFALSSGDVPTVASEIPSILKKVYLVGKDQFLQSSVMVLMISCKNA
CSEKWFQPTDCTEILRMANELSGKFCTPVSQPDNDSTVIQIISTIMPRYYPQLKFERLVT
SLEAKVGYDVLMADFFIHKNVPREEKINLIVVQKEDLNASSCIANPPHVSFLVNGKGVDK
RTNVSMETGPQFPTDITRMLKYGANIIQAIGYFNANYIIAVAFLNKLESFDAPNLNDYAQ
PVAADPPDSDLLEGPSRVSLKCPISFRRIKTPIKGRLCKHYQCFDYDNYMELNLRKPTWR
CPFCNTPSNFTDLRIDQKMVKILQETGEDTIDVLVFADGSWKAISTNDERSDRHSSDVIQ
QSRDTMDTDATADDVIDLINEDNDGDVPMSFTSASEDVKPFLNCQDLSVADYLSDLPMNT
VSQAEDLYAGGASRGNNERGNATSTSGQNSSLPSTGGLGSSSFGTLESILPHNILHPVIT
DAVSPSLDTSNSVVLRQHVAQGTRSDIVPSQPRIDPQLRLEIARPPIPRNVAREPTGIQA
LPVQPQRVRPNIYNCPPPFPQSSPASAYQVHQVTNADSVITAMSTGIGSLSRAPDAAPLL
QHQSTQQEIRATQNYHQGQFIGLTAPQNFMGTRPPPGVPGQAIGANAHGAPPAQQSHHVH
RLVSNLMNQLGQATVAQPSTAPQVLPSQPGGTSAVNPQIRGHLFPAQQRSQAMRPQAVPR
PTISQAPPRAQSPFLPATARPPSTPPPIGTSDDLQELPVDESWRPTGQMRGSLTGEAYSV
AIGRYNPSVNIAGQQTSHVTSQARPAGPDARR
NT seq 2619 nt   +upstreamnt  +downstreamnt
atggcgagcgcggcgccgctgccccccacgccgccgccatcgcagcagcagcagccgcag
ccgcagggcaaggagcagcagcagcagatggcggtggcgatgaacgcgcgccgcctggtg
atgatcggggaccgcctcaggacccacttccgcggcggcggcgggaccgtcctcgagccg
cccgacctcgcgcacctcgtctacgccttcgccagagggatcgatttcgctctttctagc
ggcgatgttcctaccgtggccagtgaaatacccagcattttgaagaaggtgtatctggta
ggaaaagatcaatttctgcaatcttctgttatggtgctaatgatatcatgcaagaatgct
tgttctgaaaaatggtttcaacccacagattgtactgaaattctcaggatggctaatgag
ctctctggcaaattctgcacgcctgtcagccagccagataatgacagcactgtgatccaa
attatttcaacaataatgccaaggtactatcctcaattgaagtttgaacgtctagtcact
tcgctggaagcaaaggttggatatgatgttttaatggccgattttttcatccataagaat
gtgcctcgagaggaaaagattaatctaattgttgtgcaaaaggaagacttaaatgcctca
tcatgtattgcaaacccgccacatgtgagctttttagtcaatggaaaaggcgtggacaag
aggacaaatgtttcaatggaaacaggaccccagttccccactgatattactaggatgctc
aaatacggggcaaacatcatccaagctataggatattttaatgctaactatatcatagct
gttgcatttctgaataaattggagtcctttgacgctccaaacctaaatgattatgcacaa
ccagtcgctgctgatcctcctgattctgatttactcgaagggccatctagagtttccctg
aagtgccccataagttttaggcgcataaaaactcccatcaaagggcgcctatgcaaacac
tatcagtgttttgattatgataattacatggagttgaacttgaggaagccgacttggcgc
tgtccattttgtaatacaccttcaaacttcactgacctacggattgatcaaaagatggtc
aagatattacaagagactggagaagatactattgatgtccttgtgtttgctgatggatct
tggaaagccatttcaactaatgatgagagatctgatagacattccagtgacgtcattcag
cagagtagagatactatggacactgatgcgactgctgatgatgtcatagatctgataaat
gaagacaatgatggtgatgtgccaatgagttttacctctgcatcagaagatgtgaagcct
ttcttgaattgtcaggatctatctgtggcagactatctttcggatttgcctatgaacaca
gtttcgcaggcagaagatctatatgcaggcggtgcaagccgtggaaacaatgaacgtgga
aatgccacttcaacttctggccaaaattcatcactgccttctactggcggtctgggctct
agttcattcgggactttggagtctattctgcctcataacattctgcaccctgttatcaca
gatgcagtctctccttctcttgatacctctaattctgtagttctgagacagcatgtagca
caaggaacacgttctgatattgtgccgtcgcaaccacgaatagatccacagcttagatta
gaaattgcaagacctcctataccaaggaatgtcgcgagagaacctacaggaattcaggct
ctgccagtgcaaccacagagagtgcgaccaaatatctacaattgtccacctcctttccca
caatccagtccagcttcagcatatcaagtacatcaggtgacaaacgcagatagtgtcatt
actgctatgagcactggtattggatcactatcaagggctccagatgctgctccgttattg
caacaccagtcaacacagcaggagattcgagccacgcaaaactatcatcaaggccagttc
attgggcttactgctcctcaaaatttcatgggtacaagaccgccgccaggagtcccagga
caggctataggtgctaatgcccatggagctccccccgcacaacagtcccatcacgttcat
cggctagtgagcaatctaatgaatcaacttggacaagctacagtggctcaaccttccaca
gctccacaggtcttgccatctcaaccaggcggcacaagtgcagtcaacccgcagatccgc
ggtcatcttttccctgcgcaacaacgcagccaagcaatgagaccacaagcagtgccccga
cctacaatttctcaggcaccacctcgtgcacagtctcccttcttgccagctactgctcgg
cctccgagcacacctccccctatcggaacttccgatgatcttcaggagcttcctgtggat
gaaagctggcgtcccacagggcagatgagagggagcctgactggtgaagcttacagcgta
gcgattggacgctacaaccccagtgtgaacattgctggtcagcagacaagtcatgtgaca
agtcaggctcggccagctggtccggatgcgcgcaggtaa

DBGET integrated database retrieval system