KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340439
Entry
4340439           CDS       T01015                                 
Name
(RefSeq) pantothenate kinase 1 isoform X2
  KO
K09680  type II pantothenate kinase [EC:2.7.1.33]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4340439
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     4340439
SSDB
Motif
Pfam: Fumble TssD Mto2_bdg CCDC92 MAD HALZ Herpes_BLRF2 ZapB Cnn_1N DivIC TSC22
Other DBs
NCBI-GeneID: 4340439
NCBI-ProteinID: XP_015644088
UniProt: Q69TF4
LinkDB
Position
6:5420879..5427229
AA seq 666 aa
MGGLRVDLSGAEIRVDPACGAAADDGGSPPVFLPRQPAAPPLLALDIGGTLIKLVYTASC
GGGGAELRFAKFERRRMQECFDFVRAQGLVHRNGSTMGSSKENIALKASGGGAYKYTEDF
REKLGVCLDKVDEMDSVVSGANFLLQSVPGAAFTHMNGKKSSVDISPNNLFPYLLVNIGS
GVSILKVTGNRKFERVTGTHIGGGTMFGLAKLLTGCKSYDEFLQLSQKGDNFVLDLIVKD
ICGELVCQKQGLSTSTLASSFGKVITSKKKLTDYRPEDLASTLLSAFTYNIAQISFLVAS
ILHLRRVFFGGSYIRGHKSTMQNISYAIDFWSQSKMQAVFLQHEGYLGALGALMSYGDSG
DKNMNLEEMKEEENIHESATPIDETSTDEHNDGNIFPYLLVNIGSGVSMIEVTGNGKFER
IIGSHLGGGTILGLARLLTGCSSYDEFLELSQRGNNLAVDLTVGDIYGEHGYPKIGLPAS
TTAASFGKVSSSRLSEYKVEDLAAALLNSFTYNIGQIAYFVANLSGLKRIFFRGAYICGH
EKTMDKISHSLKYWSKGQVQTTFLCHEGFLGTLGAFWSYENMGIDGLAAHEVIREVLLGA
PYTGQLPSLPLTHQQDNGEDTTIEGEVERLRHDNAVLKAELERLQRENTELKAKLVKSGK
PNTFYH
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgggtgggcttcgtgtcgacctctccggcgcggagatccgcgtggaccccgcgtgcggc
gccgccgccgacgatggcgggagcccgcccgtgttcctcccccgccagcccgccgcgccc
ccgctcctcgcgctcgacatcggagggactctgataaagctggtgtacacggcgagctgc
ggtggcggaggcgcggagctgcggttcgccaagttcgagaggcggaggatgcaggagtgc
ttcgacttcgtcagggcgcagggtctcgtccaccgcaatggatcaactatgggttcaagc
aaagaaaatatagcattgaaggcctcaggtggtggagcatataaatatactgaagatttt
cgtgagaaattaggagtttgtcttgacaaggttgatgaaatggatagtgttgtttctgga
gcaaactttttgttacagagtgttcctggagcagccttcacacacatgaatggaaagaaa
agttctgttgatatttccccaaataacttgtttccttaccttcttgtcaacattggctct
ggagttagcatattaaaggtcactggaaataggaaatttgaaagggtaactgggacacat
attggtggcggaacaatgtttggtttagcaaaacttttaacaggctgtaagagttatgac
gagttcttacaattaagccagaaaggggacaattttgttcttgatctaattgtgaaggat
atatgtggggaacttgtttgccagaagcaaggactttcaacttcaactcttgcttctagt
tttgggaaagttatcacttctaagaagaagttaacagattacagacctgaagatctagca
tccacattgttgagcgcttttacctataacattgcacaaatttctttccttgttgcatca
atcttgcatctcagaagagtgttctttggtggatcttatatacgtggacataagagcacg
atgcaaaatatttcttatgcaattgacttctggtcgcagagtaaaatgcaagctgtcttc
ttgcaacatgaagggtatttaggagctcttggtgccttaatgagttatggtgattctgga
gataaaaacatgaaccttgaggaaatgaaagaggaggagaacatccatgaatcagcaaca
cctattgatgagacatcaacagatgaacataatgatggaaacatatttccttatctcctt
gttaatattggatcaggtgtcagcatgatagaggtaactggaaatgggaagtttgagcgg
attataggatctcacctaggtgggggcactatccttggtctggcgaggcttttgactggt
tgttcaagttatgatgaattcttggagttgagccagagaggcaataatttagctgttgat
ttgactgttggtgacatatatggggagcatggttacccaaagattggtcttcctgcgtcc
actactgcagctagctttggaaaagtgagttcaagtagactttcggaatacaaagtagag
gatcttgcggcagctctattgaattctttcacctacaacattgggcagatagcctacttt
gtagctaatctttctggtctgaagagaattttcttccgaggtgcttatatctgtggccat
gagaagactatggacaagatttcccattccctcaagtattggtccaaaggccaagttcaa
acaacatttctgtgccatgaggggttcttgggaacactaggtgcattttggagctatgag
aacatgggtattgacggcttggcagcacatgaagtcataagggaggtcttgcttggcgct
ccttacactgggcagcttccatctctgcctctgactcaccaacaggacaatggagaagat
acgaccattgaaggagaagtagaacggcttcgacatgacaatgctgtgctgaaggctgag
cttgaacggttacaaagggagaacacagagctcaaagcgaagctggtaaaatctggcaaa
ccaaataccttttatcattaa

DBGET integrated database retrieval system