KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340604
Entry
4340604           CDS       T01015                                 
Name
(RefSeq) DNA polymerase beta isoform X2
  KO
K03512  DNA polymerase lambda [EC:2.7.7.7 4.2.99.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
osa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4340604
   03450 Non-homologous end-joining
    4340604
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4340604
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     4340604
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.-
     4340604
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     4340604
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     4340604
SSDB
Motif
Pfam: DNA_pol_B_palm DNA_pol_lambd_f DNA_pol_B_thumb HHH_8 HHH_5 BRCT_2 NTP_transf_2
Other DBs
NCBI-GeneID: 4340604
NCBI-ProteinID: XP_015643819
UniProt: Q67VC8
LinkDB
Position
6:complement(7128081..7133666)
AA seq 549 aa
MAPKRKPPARAAAAKLDPDGMFRGVSAFVVPHAVQSRRLEVWKQRLAQMGGRVQEKLAAK
GGGGAVTHVLAADAKALLRELDAAWLHRFRGSVVSFEWLEECLKSGERLPEHKFAINYEE
EFKPKKEGGAAGSGVLQSAKRSKISSDGPENRKETAGGNRESRDAIAHPNEDSDVVKGPS
TCTSSQSASGDSKETIASQNAFKAEEASSGESSTYAPPDLNRNITEIFGKLINIYRALGD
DRRSFSYYKAIPVIEKLPFKIESADQVKDLPAIGKSLKDHINEIVNTGKLSKLEHFENDE
KVRTVSLFGEVWGVGPATALKLYDKGHRTLDDLQKDDSLTSAQRIGLKFFDDIKQRIPRH
EVSEMEKLLQEVGTDILPGVIIVCGGSYRRGKSSCGDMDIIITHPDGESHVGFLPKFVQR
LKGINFLREDLIFSIHSIEGTDCGVDTYFGLCTYPGRELRHRIDLKVYPRNRHAFGLLAW
TGNDVLNRRLRILADSKGYILDDTGLYLATPGSGGKRGGRSDAIINCDTEKDVFDTLGFP
WLEPHERNL
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggctccgaagcggaagccgccggcgagggcggcggcggcgaagttggaccccgacggc
atgttccgcggcgtctccgccttcgtcgtcccccacgccgtccagtctcgccgcctcgag
gtgtggaagcagaggctggcgcagatggggggacgcgtccaggagaagctcgccgccaag
ggcggcggcggcgcggtcacccacgtcctggccgccgacgccaaggcgctgctccgggag
ctcgacgccgcctggctccaccgctttcgcgggagcgtggtgtcattcgagtggctggag
gagtgcctcaaatccggggagaggctaccggagcacaagtttgctatcaactacgaagag
gaatttaagccgaagaaggaaggtggtgctgcaggttcaggtgtgttgcagtctgcaaag
aggagcaaaatatcatcagacggtcctgagaatcggaaggaaactgctgggggtaatcga
gaatctcgagatgcaattgcacatccaaatgaagattcggatgttgtaaaggggcctagc
acgtgtacaagtagccaaagtgcctctggagattctaaggaaaccatagcttctcaaaat
gcattcaaagctgaggaagcctcttctggagaatcctcaacgtatgctcctccagacttg
aacaggaacataactgagatttttggaaagctgatcaatatatatagagccctgggagat
gaccgaagatcatttagctattacaaggctattccagtgattgagaaattgccattcaaa
atagaaagcgctgatcaagttaaagacctccctgctattgggaaatcattgaaagaccat
attaatgagatagtaaatacaggaaagctttccaagctagagcactttgagaatgatgag
aaggttcgaactgtcagcctatttggcgaagtttggggtgttggtcctgcaactgctctc
aagttatatgataaaggacatcgtacactggatgaccttcaaaaagacgattcacttaca
agtgctcagaggattggcctgaagttctttgacgatatcaaacaaagaataccccgacat
gaggttagtgagatggagaagcttttgcaagaagttgggactgatatcttgcctggggtg
ataattgtatgtgggggatcatacagacgtggaaaatcttcttgtggtgacatggatatt
attatcactcatcctgatggtgaaagtcatgtaggctttttaccaaaatttgttcagcgc
ttgaagggcatcaattttttgagggaggatcttattttcagcatacacagcattgaggga
actgattgtggagttgacacatattttggtctttgcacatatcctgggcgtgagctgcgc
catcgcatcgacctcaaggtatacccaaggaacagacatgcatttgggctgcttgcttgg
actggcaatgatgttctgaatcgacgattaagaatactagcagattccaaaggctacatt
cttgacgacactggtttgtatcttgctacaccgggcagtggtggaaagcgtgggggaaga
tcagatgctataattaattgtgacaccgagaaggatgtgttcgatacacttggattcccc
tggttggaacctcacgaacgtaatctctag

DBGET integrated database retrieval system