KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340826
Entry
4340826           CDS       T01015                                 
Name
(RefSeq) ERAD-associated E3 ubiquitin-protein ligase HRD1 isoform X1
  KO
K10601  E3 ubiquitin-protein ligase synoviolin [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4340826
   04120 Ubiquitin mediated proteolysis
    4340826
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4340826
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4340826
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4340826
SSDB
Motif
Pfam: zf-RING_2 zf-rbx1 zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 zf-C3HC4_3 zf-ANAPC11 FlxA zf-RING_16 zf-RING_11 zf-RING_5 zf-HC5HC2H zf-C3HC4_4
Other DBs
NCBI-GeneID: 4340826
NCBI-ProteinID: XP_015644046
UniProt: Q5Z880
LinkDB
Position
6:complement(11237435..11242829)
AA seq 500 aa
MIRLQTYAAFSLMATATAVYYAFSSREQFYPAMVYLSTSKICFVLLLNTGLVAMCVAWQL
VKRLFLGTLREAEVERLNEQAWREVVEILFAVTIFRQDFSVSFLAMVAALLLVKALHWLA
QKRVEYIETTPSVPMLSHARIVSFMLFLLVVDCLFLSNSLRSLIHKREASVAIFFSFEYM
ILATSTVSTFVKYIFYVSDMLMEGQWEKKAVYTFYLELISDLVHLSLYMLFFIAIFLNYG
VPLHLIRELYETFRNFRIRIADYVRYRKITSNMNERFPDATADELNASDATCIICREEMT
TAKKLLCGHLFHVHCLRSWLERQHTCPTCRAPILPPDNGRTAARPHGVHPGVQPVPGNGT
PGSERAAGENISRRQAKLEAAASAASLYGRSFAYPPANNLNRYSTPPQSTSNGPQSGEAS
TSNQSPKGHATADPSAPTFYARGAVSSVTTTRELESSLQKAYENAIKSQIEMLQIQLQMF
QHGATSSATNNENGEHTKSD
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgattcggctgcagacgtacgcggcgttcagcctgatggcgacggcgacggcggtgtac
tacgcgttcagcagcagggagcagttctacccggcgatggtgtacctctccacctccaag
atctgcttcgtgctgctcctcaacacgggcctcgtcgccatgtgcgtcgcctggcagctc
gtcaagcggctcttcctggggacgctccgggaggccgaggtggagcggctcaacgagcag
gcgtggcgggaggtggtggagatcctcttcgcggtcaccatcttcaggcaggacttctcc
gtctccttcctcgccatggtcgccgcgctgctgctcgtcaaggcgctgcactggctcgcg
cagaagagggtcgagtacatcgagaccacgccctccgtgcccatgctgtcgcacgccagg
atcgtctccttcatgctgttcctgctcgtcgtcgactgcctcttcctgtccaactcgctc
aggtcgctcatacacaagcgggaggcgtctgttgcaatcttcttttcgtttgagtacatg
atactagcaacatccacagtatcgacattcgtgaaatatatattctatgtcagtgacatg
ctaatggaaggtcaatgggagaaaaaggcagtgtatacattttacttggagctcatcagt
gaccttgtacacttgtctttgtatatgctcttcttcatagctatcttcctgaactatggt
gtcccactgcacttgatacgtgagctgtatgagacatttcgcaacttcagaatccgtatc
gcggattatgtacgctacagaaagataacttccaacatgaatgaaagatttccagatgcc
acagcagatgagctcaatgcgagtgatgctacatgtattatttgccgtgaggagatgacc
acagcaaaaaagctgctttgtgggcacctgttccatgtccattgtttgaggtcatggtta
gaacgccaacacacttgccctacatgtagagctccaattctgcccccagataatgggcgt
actgcagcacgtccgcatggagttcatcctggagttcagcctgttccaggtaatggcaca
ccaggttcagaacgagcagcaggtgagaacataagcaggcgccaagcaaaacttgaagca
gctgcttcggctgcttccctatatgggagatcctttgcttatcctccagcgaacaatttg
aacaggtattcaactcctccacagtctacatcaaatggtccacaatcaggagaagcaagt
acttccaatcaatcgccaaaaggccatgcaactgccgatccttcagcgcctactttttat
gcacgtggtgctgttagttcagtgacaactaccagggaacttgaaagttcactgcagaag
gcatatgaaaatgctataaagagccagatagagatgttgcaaatccagctgcaaatgttt
cagcatggggctacttcatcagcgactaacaatgaaaacggtgagcacacaaaaagcgac
tga

DBGET integrated database retrieval system