KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340892
Entry
4340892           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein 1B-21, chloroplastic
  KO
K08907  light-harvesting complex I chlorophyll a/b binding protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4340892
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4340892
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCI
    4340892
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4340892
NCBI-ProteinID: XP_015644330
UniProt: Q5ZA98 Q0DCJ6 Q9ZSU0
LinkDB
Position
6:12452660..12454083
AA seq 241 aa
MATSGLRSCSAVGVPSLLAPSSNRSRLPVCAYATTSGRVTMSAEWMPGQPRPAHLDGSSP
GDFGFDPLGLATVPENFERFKESEVYHCRWAMLAVPGVLVPEALGLGNWVQAQEWAAEPG
GQATYLGNPVPWGTLPTILVIEFVAIAFAEHQRTMEKDPEKKKYPGGAFDPLGFSKDPVK
FEEYKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLASHLSDPWHNNIGDIIIPRTIY
P
NT seq 726 nt   +upstreamnt  +downstreamnt
atggcgacgagcgggctgaggagctgcagcgcggtgggcgtgccgagcctgctggcgccg
tcgtcgaacaggagccgcctgccggtctgcgcctacgccaccacctccgggcgcgtcacc
atgtccgccgagtggatgccgggccagccacgccccgcccacctcgacggctcctctccc
ggtgacttcgggttcgacccgctgggcctcgccaccgtgccggagaacttcgagcggttc
aaggagtcggaggtgtaccactgccggtgggccatgctcgctgtgcctggggtgttggtg
ccggaggcgctggggctgggcaactgggtgcaggcgcaggagtgggcggcggagcccggc
ggccaggccacgtacctcggcaacccggtgccatggggcacgctgccgacgatcctggtc
atcgagttcgtcgccatcgccttcgccgagcaccagcgcaccatggagaaggaccccgag
aagaagaagtaccccggcggcgccttcgaccccctcggcttctccaaggaccccgtcaag
ttcgaggagtacaagctcaaggagatcaagaacgggcgattggccatgctggcttttgtg
ggtttctgcgtccaacagtcggcgtacccgggcaccggcccactggagaacctggccagc
cacctctcggacccgtggcacaacaacatcggcgacatcatcatcccgagaaccatctac
ccttga

DBGET integrated database retrieval system