KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340949
Entry
4340949           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4340949
  KO
K02907  large subunit ribosomal protein L30
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4340949
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4340949
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4340949
  Bacteria
    4340949
  Archaea
    4340949
SSDB
Motif
Pfam: Ribosomal_L30
Other DBs
NCBI-GeneID: 4340949
NCBI-ProteinID: XP_015642526
UniProt: A0A5S6R9J3 Q5Z890
LinkDB
Position
6:13554686..13555357
AA seq 114 aa
MSGSAFKAFKSRVEVAWSPKLVRGLPGTRRLHRHTLEAMSLRRCHRTVEHRTTPSLLGML
TQVKCLVVVETQEMYAARRQAEEDRRAPRPPLIVSHTRRRRGERPPQRRTRLKK
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagcgggagcgcgttcaaggcgttcaagtcgcgggtggaggtggcgtggagccccaag
ctggtgcggggcctcccaggtacgcgccgcctccaccgccacacgcttgaggccatgagc
ctccgccgctgccaccgcaccgtcgagcaccgcaccacgccctccctgctcggcatgctc
acccaggtcaagtgcctcgtcgtcgtcgagacccaggagatgtacgccgcgcggaggcag
gccgaggaggaccgacgcgcccccaggcccccgctcatcgtctcccacacccgccgccgc
cgcggggagcgcccgccgcagaggcgcactagactcaagaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344476
Entry
4344476           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4344476
  KO
K02907  large subunit ribosomal protein L30
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344476
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4344476
  Bacteria
    4344476
  Archaea
    4344476
SSDB
Motif
Pfam: Ribosomal_L30
Other DBs
NCBI-GeneID: 4344476
NCBI-ProteinID: XP_015650389
UniProt: A0A0P0XB25
LinkDB
Position
8:529345..532032
AA seq 116 aa
MSGSAFNAFKSRVAVAWSPKLYITLVRGLPGTRRLHRRTLEAMRLRRCHRTVEHRTTPSL
LGMLTQVKRLVVVETQEMYAARRQAEDDRRAPRPPLVVSHRPPAAATPTPTPTAGH
NT seq 351 nt   +upstreamnt  +downstreamnt
atgagcgggagcgcgttcaacgcgttcaagtcgcgggtggcggtggcgtggagccccaag
ctgtacatcacgctggtgcggggcctcccggggacgcgccgcctccaccgccgcacgctc
gaggccatgcgcctccgccgctgccaccgcaccgtcgagcaccgcaccaccccttccctc
ctcggcatgctcacccaggtcaagcgcctcgtcgtcgtcgagacccaggagatgtacgcc
gcgcggaggcaggccgaggacgaccgccgcgcgcccaggccacccctcgtcgtctcccac
cgcccgcccgccgctgccacgcccacgcccacgcccactgcgggccactag

DBGET integrated database retrieval system