KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340957
Entry
4340957           CDS       T01015                                 
Name
(RefSeq) signal recognition particle 19 kDa protein
  KO
K03105  signal recognition particle subunit SRP19
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4340957
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4340957
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4340957
SSDB
Motif
Pfam: SRP19
Other DBs
NCBI-GeneID: 4340957
NCBI-ProteinID: XP_015641044
UniProt: P49964
LinkDB
Position
6:complement(13677543..13681924)
AA seq 136 aa
MDGGDLRSSIKKWNVIYPVYLNSKKTVAEGRRIASGKACPDPTCVEIADCCSHLKIPHAI
ELDKAYPRDFFQVGRVRVQLKKDDGSPVNPAIKTKKQLMIQIAELVPKHHGRTKKQEPAA
SSTAGTSKGKGGKKKK
NT seq 411 nt   +upstreamnt  +downstreamnt
atggacggcggcgacctgaggagcagcatcaagaagtggaacgtcatctacccggtgtac
ctcaactccaagaagacggtcgccgagggccgccgcatcgcctccggcaaggcctgcccc
gaccccacctgcgtcgagatcgccgattgctgctcccacctcaagatccctcacgccatc
gaattggataaggcgtatccacgagatttcttccaggtgggaagggtgagagtgcagctc
aagaaggatgacggctccccagtcaatcctgcaatcaaaacaaagaagcagctgatgatc
caaatcgcggagctagtccccaagcatcatggcaggactaagaagcaggaaccagcagct
tcttcaactgcagggacttcaaaggggaaaggtggcaagaaaaagaagtga

DBGET integrated database retrieval system