KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341464
Entry
4341464           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC6
  KO
K03025  DNA-directed RNA polymerase III subunit RPC6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4341464
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4341464
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     4341464
SSDB
Motif
Pfam: RNA_pol_Rpc34 HTH_IclR HTH_24 MarR_2 HTH_20
Other DBs
NCBI-GeneID: 4341464
NCBI-ProteinID: XP_015641053
UniProt: A3BDD0 Q69XJ1
LinkDB
Position
6:complement(23870661..23874769)
AA seq 260 aa
MPPRKRPPPPAKAPEAPPETKPKISPPAKPIAAAPPPPKAVLSDTVLAALSQHERPIYKL
VFAGGDKGMSQTEIRIKTGMPTSTLTKHLRGLTSKGVLKVVNSVHKRAEKIYMDVRIDPS
PEITGGTWYRNGQLDSDAVASARRRCLDQIDKLGVATAESIHEGISRECSNLAYSTEQVR
DILRTMALDREVEEVRSTGAGEFGDLRAGRVCYRRGGPVQGGMMERIPCGVCPRIDECSP
DGVISPSTCVYYKKWLQMDF
NT seq 783 nt   +upstreamnt  +downstreamnt
atgccgccgcggaagcgcccgccgccgccggccaaggcgccggaagccccaccggaaacc
aagcccaagatctctccgcccgctaaacccatcgccgcggcgccgccgccgccgaaggcg
gtcctctcggacaccgtcctcgccgccttgtcgcagcacgagcgccccatctacaagctc
gtgttcgccggcggggacaagggcatgtcgcagacggagatccggatcaagaccgggatg
ccgacgagcaccctcaccaagcacctccgcggcctcacctccaagggcgtcctcaaggtg
gtcaacagcgtccacaagcgcgccgagaagatctacatggacgtccgcatcgacccgtcg
ccggagatcaccgggggaacctggtaccgcaacggccagctcgactccgacgccgtcgcc
tccgcgcggcgcaggtgcctcgaccagatcgacaagctcggcgtcgccacggcggagtcc
atccacgagggcatcagcagggaatgctccaacctagcctactcgaccgagcaggtcagg
gacatcctgcgcaccatggcgctcgacagggaggtcgaggaggtgaggagcaccggggcg
ggggagttcggcgacctcagggcagggagggtgtgctaccggaggggcggcccggtgcag
ggcggcatgatggagaggatcccgtgtggagtttgccccaggatcgatgagtgctcgccg
gatggcgttatctcgccgagcacctgcgtctactacaagaagtggctgcagatggacttc
tag

DBGET integrated database retrieval system