KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341664
Entry
4341664           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L35, chloroplastic
  KO
K02916  large subunit ribosomal protein L35
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4341664
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4341664
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4341664
  Bacteria
    4341664
SSDB
Motif
Pfam: Ribosomal_L35p
Other DBs
NCBI-GeneID: 4341664
NCBI-ProteinID: XP_015641634
UniProt: Q67W51 A0A0N7KMI0
LinkDB
Position
6:26442600..26444835
AA seq 146 aa
MAMSLSLARVALPPLLQQQGGAPRKLHPGALAFPAKSFFGAPLAAVAVSPASAAAASPLR
RRPSSASAVVAAGKGYKMKTHKASAKRFRVTGRGKIVRRRAGKQHLLSKKNTKRRKRLSK
MIQVNKSDYNNVTGALPYLKVNRNAE
NT seq 441 nt   +upstreamnt  +downstreamnt
atggccatgtccctctccctcgcgcgcgtcgcgctcccgcctctgctgcagcagcagggg
ggcgcccccaggaagctccaccccggcgccctcgcgttccccgccaagtcgttcttcggc
gcgccgctggcggccgtcgcggtctcccccgcgtcggcggcggcggcgtcgccgctccgt
cgcaggccgtcgtccgcctccgccgtcgtcgcggcggggaaggggtacaagatgaagacc
cacaaggcgtcggcgaagcggttccgggtgacggggagggggaagatcgtgcggcggcgc
gccgggaagcagcaccttctcagcaagaagaacaccaagcgcaggaagaggctatccaag
atgatccaagttaacaagagcgactacaacaacgtgacgggcgcactgccctacctcaaa
gtgaacaggaatgcagaatga

DBGET integrated database retrieval system