KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341698
Entry
4341698           CDS       T01015                                 
Name
(RefSeq) putative GDP-L-fucose synthase 2
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4341698
   00520 Amino sugar and nucleotide sugar metabolism
    4341698
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     4341698
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind
Other DBs
NCBI-GeneID: 4341698
NCBI-ProteinID: XP_015641892
UniProt: Q67WR5
LinkDB
Position
6:complement(26698725..26702299)
AA seq 347 aa
MPSQQRSSSGSTAKAGDADGDGDAAAVSFLGDKSAKVFIAGHRGMVGSAVHRKLDALGFT
NVVVRTRAELDLACQAAVEAFFAAELPRYVILAAAKVGGVHASSAAPAEYLTENLRITVN
VVDAARRCGSVRKLLVLASSTIYPADAPQPTPESALLTGPPAEGSEWYAIPKIAGIKMCQ
AVRAEYGLDAIAAAPNNLYGPRHPFPPEHSHVIPALIRRFHRAKLEGAGEVAVWGSGAAA
REFTHVDDLAEAVVVLMERYSGEEHVNVGSGEEVTVRELAEAVRGVVGYEGVVAWDAARP
EGVARRVVDSGRMRKLGWEPRVALRDGIQDLYRFYLRHECGGQAHHA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgccttctcagcagcgcagcagcagtggtagcactgcgaaggccggggacgccgatggc
gacggcgacgccgccgccgtatccttcctcggcgacaagtcggcgaaggtcttcatcgcc
ggccaccgcggcatggtcggctcggcggtgcaccgcaagctggacgcgctggggttcacc
aacgtcgtggtcaggactcgcgccgagctcgacctggcgtgccaggccgccgtggaggcg
ttcttcgccgccgagctgccgcggtacgtgatcctggcggcggcgaaggtcggcggcgtc
cacgcgagctccgccgcgccggcggagtacctgacggagaacctccgcatcaccgtcaac
gtcgtcgacgccgcccgccgctgcggctccgtccgcaagctgctcgtcctcgccagctcg
accatctacccggcggacgcgccgcagccgacgccggagtcggccctcctcaccggcccg
ccggcggaggggagcgagtggtacgccatcccgaagatcgccgggatcaagatgtgccag
gcggtacgcgccgagtacggcttggacgccatcgcggcggcgccgaacaacctgtacggg
ccgcgccacccgttcccgccggaacactcccacgtcatcccggcgctgatccggcggttc
caccgcgcgaagctcgagggcgccggcgaggtggcggtgtggggcagcggcgcggcggcg
cgggagttcacccacgtggacgacctcgcggaggcggtggtggtgctgatggagaggtac
tccggggaggagcacgtgaacgtggggagcggggaggaggtgacggtgagggagctcgcg
gaggcggtgaggggggtggtcgggtacgagggggtggtggcgtgggacgcggcgcggccg
gagggggtggcgcggcgggtggtggacagcgggaggatgaggaagctggggtgggagccg
agggtggcgctgcgcgacggcatccaggacctctaccgcttctacctgcgtcacgagtgc
ggcggccaagctcatcatgcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341699
Entry
4341699           CDS       T01015                                 
Name
(RefSeq) probable GDP-L-fucose synthase 1
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4341699
   00520 Amino sugar and nucleotide sugar metabolism
    4341699
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     4341699
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind NmrA
Other DBs
NCBI-GeneID: 4341699
NCBI-ProteinID: XP_015644414
UniProt: Q67WR2
LinkDB
Position
6:26708003..26709674
AA seq 328 aa
MGTVTTADPHASFLADKGGKVFVAGHRGLVGSAILRHLVSLGFTNVVVRTHAELDLTRQS
DVEAFFAAELPRYVVLAAAKVGGIHANSTFPADFIAANLQIQTNVVDAALKCGSVRKLLF
LGSSCIYPKFAPQPIPENSLLSGPLEPTNEWYAVAKIAGIKMCQAYRIQHGFDAISAMPT
NLYGPQDNFHPENSHVLPALIRRFHEAKASNAAEVVVWGTGSPLREFLHVDDLADAVIFL
MDHYSGLEHVNVGSGSEVTIKELAELVKEVVGFQGKLVWDSSKPDGTPRKLMDSSKIQEM
GWKPKVPLKEGLVETYKWYVENVISAKK
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggcaccgtcaccaccgccgatccgcacgcctccttcctcgccgacaagggcggcaag
gtgttcgtcgccggccaccgcggcctcgtcggctccgccatcctccgccacctcgtctcc
ctcggcttcaccaacgtggtcgtccgcacccacgccgagctcgacctcacccgccagtcc
gacgtcgaggccttcttcgccgccgagctcccccgctacgtcgtcctcgccgccgccaag
gtcggcggcatccacgccaactccaccttcccggccgacttcatcgccgccaacctccag
atccagaccaacgtcgtcgacgccgcgctcaaatgcggctccgtccgcaagctcctcttc
ctcggctcctcctgcatctaccccaagttcgcgccgcagccgatcccggagaactccctc
ctctccggccccctcgagcccaccaacgagtggtacgccgtcgccaagatcgccggaatc
aagatgtgccaggcttaccgcatccagcacggcttcgacgccatctcggccatgcccacc
aacctctacggcccgcaggacaacttccacccggagaattcacacgtcctgcccgcactg
atccgccggttccatgaggcgaaggcgtccaatgccgcggaggttgtcgtctggggcact
ggctcgccgctgcgtgaattcttgcacgtcgatgaccttgcagatgcggtgatcttcttg
atggatcactactcggggctggagcatgtcaatgtaggaagcgggagcgaggtgacgatc
aaggagctcgcggagctggtgaaggaggtggttgggttccaggggaagctggtatgggac
tctagcaaacccgatggcacaccgaggaagctcatggatagttccaagatacaggagatg
gggtggaagcccaaggtccccctcaaggaggggctcgtcgagacatacaagtggtatgtc
gagaatgtcatctctgcgaagaagtag

DBGET integrated database retrieval system