KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341706
Entry
4341706           CDS       T01015                                 
Name
(RefSeq) U5 small nuclear ribonucleoprotein 40 kDa protein
  KO
K12857  Prp8 binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4341706
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4341706
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    4341706
 Complex C
   U5 SnRNP specific factors
    4341706
SSDB
Motif
Pfam: WD40 NBCH_WD40 ANAPC4_WD40 eIF2A Nup160
Other DBs
NCBI-GeneID: 4341706
NCBI-ProteinID: XP_015643086
UniProt: Q0DAG8 Q67WC9
LinkDB
Position
6:complement(26778934..26781812)
AA seq 343 aa
MFPPGNNSLALSAPRPGMELANIQQHPNQALGPGGKQRTSSLEAPIMLLTGHQSAVYCMK
FNPAGTVIASGSHDKDIFLWYVHGDCKNYMVLRGHKNAVLDLQWTTDGTQIISASPDKTV
RVWDVETGKQVKKMAEHSSFVNSCCPARKWPPLVVSGSDDGTAKLWDLRQRGAIQTLPDK
YQITAVSFSEAADKVFTGGLDNDVKWWDLRKNEVTEYLKGHQDMITGMQLSPDGSYLLTN
AMDNELKIWDLRPYAPENRNIKTLTGHQHNFEKNLLKCSWSPDNRKVTAGSADRMVYIWD
TTSRRILYKLPGHNGSVNETAFHPTEPVIGSCGSDKQIYLGEL
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgttccccccaggcaacaattctttggctctttcagccccaaggccaggaatggagctg
gctaacattcaacagcatcctaatcaagctcttgggcctggtgggaagcaacgtacatcc
agtctggaggccccaataatgctactcacaggccatcagagcgctgtgtactgtatgaag
ttcaaccctgcaggaactgtgatagcatcaggctcccatgacaaggatatcttcttgtgg
tatgtccatggtgactgtaagaactacatggtactgagagggcacaagaatgctgttctt
gaccttcaatggactactgatgggactcagatcatctctgcaagccctgacaagactgtg
agagtgtgggacgttgagactggcaagcaagtcaagaagatggccgagcactcatctttt
gtcaactcatgttgcccggctcgaaagtggccacctctggttgtaagtggatcggatgat
ggaacagcaaagctgtgggatttgcgtcaaagaggtgctatacaaacacttcccgacaag
taccagattacagccgtcagcttctcagaggcggcagataaggttttcactggtggccta
gacaatgatgtcaaatggtgggatctccgtaagaatgaagtgacagagtatctcaaagga
caccaggacatgataaccggaatgcagcttagtccagatgggtcttatctcctaaccaat
gcaatggacaatgagctcaaaatctgggacttgcgcccttacgccccagagaaccggaac
atcaagaccctcacaggacaccagcataactttgagaagaacctgttgaagtgcagctgg
tcccctgataatcgcaaggtcactgccgggagtgctgatcgcatggtctacatctgggac
acaacatcaaggcggatcttgtacaagcttcctggccacaacggttctgtcaacgagacc
gcattccatcccaccgagcctgtcattggatcttgcggcagtgacaagcagatttatctt
ggggagctttaa

DBGET integrated database retrieval system