KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342149
Entry
4342149           CDS       T01015                                 
Name
(RefSeq) coiled-coil domain-containing protein 12
  KO
K12871  coiled-coil domain-containing protein 12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4342149
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4342149
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4342149
 Complex C
    4342149
SSDB
Motif
Pfam: cwf18
Other DBs
NCBI-GeneID: 4342149
NCBI-ProteinID: XP_015642992
UniProt: Q5Z414 B9FR11
LinkDB
Position
6:31147906..31150544
AA seq 182 aa
MEDAAARRERLRALRAAKDLLSTPDPAAAGQGQHHQNGNRETAPEQAEHPTLPAPLDAPE
EASKENINPTDESEEVQNDGDMPAMKFRNYLPHDEQLRGGKVAPVSLPKFEDPISAETTE
PKQVENPFGNIAPKNPNWDLKRDVQKRMDKLEKRTQKALAEIALEQQKEKEALGEGSDAA
QD
NT seq 549 nt   +upstreamnt  +downstreamnt
atggaagacgctgccgcccgccgcgagcgcttgcgtgcccttcgcgctgccaaggacctc
ctctccacccccgaccccgccgccgccggacaaggacaacaccaccaaaatgggaaccgt
gagacagcaccagaacaagcggagcatccaactttaccagctcctctggacgcacctgag
gaggcctcaaaggagaacattaaccccactgacgaatctgaggaggttcaaaatgatggt
gatatgccagccatgaagttcagaaactaccttcctcatgatgagcaacttcggggtggt
aaggtggctccagtgtccctcccaaagtttgaggatccaatttctgctgaaactacagag
ccaaagcaagttgagaacccctttggaaacatagctccaaagaatccaaattgggatctg
aaaagagatgtgcagaagaggatggacaaacttgagaagcgcacgcagaaagcactggct
gagattgcattggaacaacaaaaggagaaagaagcacttggggaaggaagcgatgcagcc
caagattga

DBGET integrated database retrieval system