KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342350
Entry
4342350           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4342350
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4342350
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     4342350
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like
Other DBs
NCBI-GeneID: 4342350
NCBI-ProteinID: XP_015646992
UniProt: Q6ZDY8
LinkDB
Position
7:complement(1860674..1866551)
AA seq 630 aa
MWRGCVSRGLRSLSKGKGSSSSAPVSAAARLFSTASSSYTVVDHSYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DSIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRT
GHAMLHTLYGQAMKHNTQFFVEYFALDLIMDSEGTCQGVIALNMEDGTLHRFRATNTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTMKGDNPDSVVPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAETAKPGEKQKPLQKSAGEKTIA
WLDKLRNANGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLITKAWESYHDVKISDR
SLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEQWMKHSLGYWE
NEKVRLAYRPVHMNTLDSEVESFPPKARVY
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgtggcgcggctgcgtctcgcgtggcctcaggagcctctccaagggcaagggctcctcc
tcctccgcccccgtctccgccgccgctaggctcttctccaccgcctcgtcgtcgtacacg
gtggtggatcactcgtatgacgcggtcgtggtgggagccggcggcgcggggctccgtgcg
gcgatcgggctctccgagcacgggttcaacacggcttgcatcaccaagctcttccccacg
cggtcgcacaccgtcgcggcgcagggtggcataaatgctgctcttggaaacatgacggaa
gatgactggagatggcatatgtatgacactgtcaagggtagtgattggcttggtgaccag
gattctattcagtatatgtgcagagaagcaccaaaagcagttatagaacttgaaaactat
gggttgccattttcaagaactgaagatggaaagatataccaacgggcctttggaggccag
agcttagattttgggaaaggtgggcaggcctatcgatgtgcatgtgctgctgacagaaca
ggacatgctatgttacacactctgtatggtcaagcaatgaagcataatactcagttcttt
gtagaatattttgcgctagaccttatcatggacagtgaaggcacctgtcagggggttatt
gctttgaacatggaggatggcactcttcaccgtttccgtgctacaaatacaattctggcc
acaggaggttatggcagagcctacttctcagcaacctcagctcacacatgcactggagat
ggcaacgctatggttgcacgtgctggtttaccacttcaggaccttgagtttgtgcagttc
catcctacaggcatttatggtgctggatgccttatcactgaaggttcccgtggtgaaggt
ggtatccttaggaacagtgaaggcgagcgtttcatggaacgatatgctcctactgcaaaa
gatcttgcttctcgagatgttgtttcaagatctatgacaatggaaatcagagaaggccgt
ggtgttgggccattgaaggaccacatctatctgcatcttaaccatctgcctccagaagtt
cttaaggagaggcttcctggtatttctgaaactgctgctatttttgctggtgttgatgtc
accaaggagcccattcctgtcttgcctactgtgcactataatatgggtgggatcccaaca
aattaccatggagaggtagtgactatgaagggtgacaatcctgattctgttgttcctggt
ttgatggctgcgggagaagcagcatgtgcatctgttcatggtgcaaatcgtctgggtgca
aattcacttcttgacatagttgtttttggcagagcttgtgcaaacagggtagctgaaacc
gctaagccaggtgagaagcagaaacctcttcaaaaaagtgctggagaaaagaccatagcc
tggttagacaagctgagaaatgcaaatggatcattgccaacttccaagatccgtctaaac
atgcaacgtgttatgcaaaataatgctgctgtcttccgtacgcaagaaacactcgaggaa
ggttgcaaattgattaccaaggcatgggaaagttatcatgatgtgaagatcagtgaccgg
agtctcatatggaattcagatttgatagagaccattgagttggaaaatctcttgataaat
gcatgcataaccatgcactcagcagaggctcggaaggaaagcagaggagctcatgctcgt
gaagatttcacgaaaagagatgatgagcaatggatgaagcactcgctggggtactgggag
aatgagaaggttcgcttggcatacaggccagtccacatgaacacattggacagtgaagtt
gagtcgttcccacccaaggcgcgtgtttattag

DBGET integrated database retrieval system