KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342517
Entry
4342517           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 11
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4342517
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4342517
   03400 DNA repair and recombination proteins [BR:osa03400]
    4342517
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     4342517
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4342517
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L HBM
Other DBs
NCBI-GeneID: 4342517
NCBI-ProteinID: XP_015645140
UniProt: Q6ZA50 Q0D8B1
LinkDB
Position
7:complement(3813968..3817352)
AA seq 120 aa
MNAPDRYERFVVPEGTKKVSYERDTKIVNAGSFTIEREDHTIGNILRMQLHRDPNVLFAG
YKLPHPLQYKILVRVHTANQSTPTQAYTQAINDLDKELENLKQAFEDEKIRYEERPKQGY
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaatgctcccgaccgctacgaacgctttgtggtgcctgagggaaccaagaaggtatca
tatgagcgggatacaaagattgtgaatgctgggtcattcacaattgagcgtgaggaccac
accattggcaacatcctccgcatgcagctccacagggacccaaacgtcctctttgctggt
tataagctccctcatccccttcagtacaagatccttgtcagggtccatactgcaaaccag
tccacccctactcaagcgtacacacaggcaatcaatgatttagacaaggagcttgagaat
ctcaagcaagcttttgaggatgagaagatccgctacgaggaaaggcctaagcagggatac
tag

DBGET integrated database retrieval system