KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342646
Entry
4342646           CDS       T01015                                 
Name
(RefSeq) phosphoacetylglucosamine mutase
  KO
K01836  phosphoacetylglucosamine mutase [EC:5.4.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4342646
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.3  phosphoacetylglucosamine mutase
     4342646
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_IV PGM_PMM_III CinA_KH
Other DBs
NCBI-GeneID: 4342646
NCBI-ProteinID: XP_015644787
UniProt: Q6ZDQ1
LinkDB
Position
7:complement(5179086..5182822)
AA seq 562 aa
MAELAAGGDQRAALLAAATLFPPPPDGARFSYGTAGFRAEGAAMGPAVCRAGVVAALRSA
KLGGAAVGVVITASHNPVRDNGVKIVDADGGMLSQDWEPFADALANAPNPDALLQIVLQF
AKDEDIKLGGSHSAQVLLARDTRPTGEYLLDVAVKGVNAVIGAVAVDMGILTTPQLHWMV
RSKNKGLKSSETDYFSQVIDSFRCLLELVPKDKEADVINNRLIVDGANGIGGLKLEEIKA
KISGLDIHVRNSGKGEGILNESCGADFVQKEKVVPLGFGPEDVGFRCASFDGDADRLVYF
RIVSSSDTRIDLVDGDKILSLFVLFIREQLDIINGKDNKGNEVLPTRFGVIQTAYANGAS
TDFLKNIGLEVVFTPTGVKYLHKEALKYDIGIYFEANGHGTVLFSDHFVSQLESLTSEFS
SKAAGSSQHQAAMRLLATSQLINQAVGDALSGMLLVEAVLQYKGWSFQNWCDLYTDLPSR
QLKVKVQDRNSIVTTDAERRVCQPNGLQELIDGEISNYSHGRCFVRPSGTEDVVRVYAEA
SSEEAADCLAKRVAQHVERILG
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggccgagctcgcggcgggaggcgaccagcgcgccgcgctgctcgcggcggccaccctc
ttcccgccgccgcccgacggcgcgaggttctcgtacgggacggcggggttccgcgcggag
ggggccgccatgggccccgcggtgtgccgcgccggggtggtggcggcgctgcggtcggcc
aagctgggcggcgccgccgtgggggtggtcatcacagcctcgcacaacccggtccgcgac
aacggcgtcaagatcgtcgacgcggacggcgggatgctgtcgcaggactgggagccgttc
gccgacgcactcgccaatgcccccaaccccgacgccctcctccagatagtgcttcagttt
gcaaaagatgaggatattaaacttggtggaagccactcggcacaagtgctgctggcaaga
gacacgaggccaactggagagtacctccttgatgtggcggtgaagggagtaaatgcggta
ataggtgcagtagcagttgacatggggatcctcaccactccacagctgcattggatggtc
cgaagtaaaaacaaaggactgaagtcttctgagacggattatttttcacaagttattgat
tcattcaggtgtttattggagttagtcccaaaagataaagaagctgatgtgataaacaat
agactaattgtggatggagctaatggcattggtgggttgaaacttgaagaaataaaggca
aaaatctctggattagacattcatgtgaggaattcagggaagggagaagggatacttaat
gagagttgtggtgcagactttgttcagaaggagaaagttgttcctcttggctttggtcct
gaagatgtcggtttcaggtgtgcaagttttgatggcgacgctgaccggcttgtttatttc
cgtatcgtatcctctagtgacactaggattgatctcgttgatggtgacaagatattatca
ctattcgtgctgtttattagagagcaattagatattatcaatggaaaagacaataaagga
aatgaagtacttcctacacgttttggtgtaattcaaacagcttatgcaaatggtgcatca
acagattttctcaagaacattggtctcgaagttgtattcactccaactggagtgaaatat
cttcacaaggaagccctaaaatatgatatcggtatctactttgaagccaatggacatggg
acagtgctattctcagatcattttgtctcacaactggaatctttgaccagtgagttttct
tcaaaggctgcaggttcttcacaacaccaagctgctatgagattgttggccacaagtcag
ctaattaatcaggcagttggagatgctttaagtggaatgcttttggtggaggctgttttg
caatacaagggctggtcgtttcagaattggtgtgacctgtacactgatctgcccagtaga
caattgaaggttaaagttcaagatcgaaattctattgttacaacagatgcagaaagaagg
gtttgccagcctaatgggctgcaggaactgatagatggggagatatcaaattactctcat
gggcgatgtttcgtgcggccatctggtaccgaggatgtggtgcgtgtatatgcagaggca
tcttcagaggaagcagctgattgccttgcaaaacgagtggcgcagcatgttgagcgcatt
cttggataa

DBGET integrated database retrieval system