KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343018
Entry
4343018           CDS       T01015                                 
Name
(RefSeq) F-actin-capping protein subunit alpha
  KO
K10364  capping protein (actin filament) muscle Z-line, alpha
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4343018
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4343018
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4343018
   04147 Exosome [BR:osa04147]
    4343018
Membrane trafficking [BR:osa04131]
 Protein recycling
  Others
   WASH complex
    4343018
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     4343018
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4343018
SSDB
Motif
Pfam: F-actin_cap_A F_actin_cap_B
Other DBs
NCBI-GeneID: 4343018
NCBI-ProteinID: XP_015645189
UniProt: Q8H358
LinkDB
Position
7:complement(13074399..13078578)
AA seq 297 aa
MSDGEEKREIAVWFLSNAPAGEIHYVAKDVRALLGDEAVYEAAAAEAFPEHNKAHLVALE
LPDRSGDIIITTYGELDKNNYLDPRTAQVATVDHIKQKCTKLRPAADEELPSAYIEDFRS
ALDVELSKYVGEAYPKGVCAVYCTSGKDIEGPGVDFRFAAVISAAKRSPQNFCNGNWRSI
WTLEFIDGLQLVEIKGKIQVGAHYFEEGNVQLDTNIDCKDSTILQSPEECAVSITNIIRH
HESEYLSSLEESYMNLSDATFKDLRRKLPVTRTLFPWHNTLALSLTRDLTKELAIGK
NT seq 894 nt   +upstreamnt  +downstreamnt
atgtcggacggtgaggagaagagggagatcgccgtctggttcctctccaacgcccccgcc
ggcgagatccactacgtcgccaaagatgtgcgagcgctgctgggggacgaggcggtgtac
gaggccgccgcggcggaggccttcccggagcacaacaaggcgcacctcgtggccctcgag
ctccctgaccgcagcggtgatataattatcacaacttatggggagcttgacaagaacaat
tatctggatcctaggactgctcaagttgctacagtggaccatattaaacagaaatgtaca
aaattgaggccagctgctgatgaggagcttccttcagcatacattgaagatttcaggagt
gccctggatgttgaattatccaaatatgttggtgaagcttatccaaaaggggtgtgtgct
gtttattgtaccagcggaaaagatatagagggaccaggagttgattttcgttttgcagca
gttatttctgctgctaaacgcagcccacaaaacttttgcaacggcaattggcgctcaatt
tggactctggaattcatagatggattacagcttgtcgaaattaaagggaaaatacaggta
ggtgctcattattttgaagagggaaatgtgcagctggatactaacatcgattgcaaggat
tccaccatattgcagtctcctgaggaatgtgcagtatcaataactaacatcattcggcat
catgagtcagaatatttgtcatcacttgaggaatcatacatgaatttgtctgatgcaacc
ttcaaggatcttcgaaggaaacttcccgttactcgtactcttttcccatggcacaacaca
ttagccctcagccttacaagagacctcaccaaagaactggctataggaaaatga

DBGET integrated database retrieval system