KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343069
Entry
4343069           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 8 homolog A
  KO
K03031  26S proteasome regulatory subunit N12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4343069
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4343069
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4343069
SSDB
Motif
Pfam: CSN8_PSD8_EIF3K SAC3_GANP CoA_binding_3
Other DBs
NCBI-GeneID: 4343069
NCBI-ProteinID: XP_015648042
UniProt: B9FWY1 Q8W423
LinkDB
Position
7:complement(14527455..14530535)
AA seq 267 aa
MDPKLVEVTQLFSRFKAAFARNDFDTCVDLLSQLKVRLTKFPSLPPSFQQTPNAVEELKI
ARDIYEHAVVLSVKIEDQDAFERDFCQLKPYYMDTCGIIPPSPQEYPILGLNLLRLLVQN
RIAEFHTELELLPVTALENPCIKHAVELEQSFMEGAYNRVLSARQAVPHETYVYFMDLLA
KTVRDELAGCSEKGYDYMSIAEARQVLMFSSDKELHQYIAEEHPEWEVKDGSVFFQKAKE
TQPCKEIPSLQVINQTLSYARELERIV
NT seq 804 nt   +upstreamnt  +downstreamnt
atggatccgaagctggtggaggtgacgcagctcttctcccgcttcaaggcagccttcgcc
aggaacgacttcgacacctgcgtagacctgctgtcgcagctcaaggtccgcctcaccaag
ttccccagccttcctccatcatttcagcagacaccgaatgcagtggaagagctgaaaatt
gcgagggacatctatgagcatgcagttgttctgagtgtgaaaattgaagaccaagatgca
tttgaaagggacttttgtcaactcaaaccttattacatggatacatgcggcataattcca
ccatcaccacaggagtatccaatcttgggtcttaatcttctaaggctgttagttcagaac
agaattgcagagttccacactgagctggaacttctgccggtcacagcacttgaaaatcct
tgcatcaagcatgcggtggagcttgagcagtcatttatggagggtgcttacaaccgagtg
ttgagcgctcgccaggctgtgccccacgaaacatatgtgtacttcatggatcttcttgcc
aaaacagtcagagatgaactggctggttgcagtgagaagggttatgattatatgtcaata
gctgaagcaagacaagtgctgatgttcagctctgacaaagaattgcaccagtacatcgca
gaggagcaccctgaatgggaggtaaaggatggttccgtcttcttccagaaggcgaaggag
acccagccctgcaaggagataccatctttgcaggttatcaaccaaacgctcagctatgct
agagagctggagcggattgtatga

DBGET integrated database retrieval system