KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343171
Entry
4343171           CDS       T01015                                 
Name
(RefSeq) 5-pentadecatrienyl resorcinol O-methyltransferase isoform X1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation Methyltransf_25 Dimerisation2 Methyltransf_12 Methyltransf_PK
Other DBs
NCBI-GeneID: 4343171
NCBI-ProteinID: XP_015645070
UniProt: A3BJI2 A0A8J8Y089
LinkDB
Position
7:complement(16346772..16349721)
AA seq 348 aa
MEHEQLVQASTELMHHSLGYVRSMALGCAAKLGVADAIHRAGGRATLHDLHAALSLHPTK
LPFLRRVMRVLVASGVFAQVKEEEDHYRLTPVSSLLVTAGRTLLPFVLLQHSPLCVTPAT
SMAEWLKTGEEETAFEMAHGAGLWGACRRAPELGDFFNDAMAADSAFIMDAAIRGARQVF
DKITSLVDVAGGTGAAARAVAAAFPHIKCTVLDLPHVIDSIPVDHGDVVQFVAGDMMDFI
PQADALLLKFVLHDWSDEDCVKILKRCKEAIPSKDKGGKVIIIDVVVGSSSQAMCYGTQL
LFDLTISMLTPGMERDEKEWFKIFNEAGFTEYKISPVLGIRSIIEVFP
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggagcacgagcagctagtgcaagccagcacggagctgatgcaccacagcctgggctac
gtcaggtccatggccctcgggtgcgccgccaagctcggcgtcgccgacgccatccaccgc
gccggcggccgcgccaccctccacgacctgcacgccgcgctgtccctccacccgaccaag
ctccccttcctgcgccgcgtcatgcgcgtgctggtcgcctcgggcgtcttcgcgcaggtc
aaggaggaggaggaccactaccgcctcacgcccgtgtcgtccctgctcgtcaccgccggc
aggacgcttctgccgttcgtgctcctccagcactcgccgctctgcgtgacgcccgccacg
agcatggccgagtggctcaagaccggcgaggaggagacggcgttcgagatggcgcacggc
gctggattgtggggcgcctgcaggcgcgccccggagctcggcgatttcttcaacgatgcc
atggcggccgactcggcgttcatcatggacgcggccatccgtggcgcacgccaggtgttc
gacaagatcacctcccttgtggatgtcgcaggcggcactggcgcggcggcgagggcggtg
gctgctgcgttcccgcatatcaagtgcacggtgctggaccttcctcacgtgatcgattcc
attcctgttgatcatggcgacgttgttcagtttgtcgcaggcgatatgatggattttatc
ccccaagcagatgccctcctgcttaagtttgtcctacacgactggagtgatgaggactgc
gtaaagatattaaaacgatgcaaggaggcaattccttctaaagataaaggagggaaagtc
attatcattgatgttgtggttggatcctcctcccaagcaatgtgctatggaacccaactg
ctgtttgatctaaccatttctatgctaacaccaggcatggagagggatgagaaagagtgg
ttcaagatattcaacgaggccgggttcactgagtacaagattagtcctgtgttaggcatt
cgatccattatcgaggtctttccataa

DBGET integrated database retrieval system