KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343220
Entry
4343220           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC8
  KO
K03022  DNA-directed RNA polymerase III subunit RPC8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4343220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4343220
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     4343220
SSDB
Motif
Pfam: RNA_pol_Rbc25 SHS2_Rpb7-N DUF5818 S1
Other DBs
NCBI-GeneID: 4343220
NCBI-ProteinID: XP_015646733
UniProt: A0A0P0X6C2 Q84NN3
LinkDB
Position
7:complement(17270834..17274719)
AA seq 202 aa
MFVLSQIEHNLPMPPHLLSRPLVDAIKAELERLFLDKVVANLGLCVSVYDIRSVEGGFIF
PGEGCSTYKVSFRLLMFRPFVGEVLVGKISGYDEKGLHVSLDFFSDISIPGHLMQYGTAR
ALDGRWMLKTEDGDELYLDLDDEIRFLVSSIKYPPIPVEQKETDRAFAPMQIIGSIKGDG
LGLLAWWAADEEEGEAEAEAEE
NT seq 609 nt   +upstreamnt  +downstreamnt
atgttcgtgctcagccagatcgaacacaacctgccgatgccgccgcacctgctgagccgg
ccactcgtcgacgccatcaaggctgagcttgagaggctcttcctcgacaaggtcgtcgcg
aacctcgggctctgcgtctccgtctacgacatccgctccgtcgaaggaggcttcatcttt
ccaggagagggctgctccacttacaaagtttcctttaggttgctgatgttcaggcccttc
gttggggaggttcttgtcgggaagatcagtggatatgatgaaaagggtctgcatgtttca
cttgatttcttcagtgatataagcattcccgggcacttgatgcagtatggcacggctagg
gcgctagatggtaggtggatgctgaagactgaagatggtgatgagctctatcttgattta
gatgatgagatacgattcttggtatctagcataaaatacccgcctatcccagtcgagcaa
aaggagactgacagggcatttgctccaatgcaaattattggaagcattaaaggagacggt
cttggtcttcttgcttggtgggctgcagatgaagaggaaggagaggccgaggccgaggca
gaggaatag

DBGET integrated database retrieval system