KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343249
Entry
4343249           CDS       T01015                                 
Name
(RefSeq) beta-ureidopropionase
  KO
K01431  beta-ureidopropionase [EC:3.5.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa00410  beta-Alanine metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
Module
osa_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4343249
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4343249
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4343249
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.6  beta-ureidopropionase
     4343249
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-GeneID: 4343249
NCBI-ProteinID: XP_015647908
UniProt: Q8H530 B9FX93
LinkDB
Position
7:complement(17820566..17823750)
AA seq 413 aa
MDSSNGERPPQGEDAPAAAAGSIGGYESLHRLLQSNLSPELFKEASRLLLGLNCGRALEA
ISLPEATSALAKAHNFDVQAFRFDADKEYLRQPRVIRVGLIQNSIAIPTTSHFADQKKAI
MEKVKPMIDAAGDAGVNILCLQEAWTMPFAFCTREKRWCEFAEPVDGESTQFLQQLAKKY
NMVIVSPILERDVNHGEIVWNTAVVIGNHGNIIGIHRKNHIPRVGDFNESTYYMEGNTGH
PVFETAYGKIGVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIA
NSYFVGSINRVGTEVFPNPFTSGDGKPQHADFGHFYGSSHFSAPDASCTPSLSRYRDGLM
ISDMDLNLCRQIKDKWGFRMTARYDTYASLLSEYLKPDFKPQVIVDPLINKSA
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggacagcagcaacggcgagcggccgccgcagggagaggatgcgccggcggcggcggcg
gggtcgatcggagggtacgagtccctgcacaggctcctccagtccaacctctccccggag
ctcttcaaggaagcaagccggctgctattgggactgaattgtgggcgtgctctagaggcc
atctcattgcccgaagccacatctgctcttgcaaaagctcataactttgatgtgcaggcc
ttccgttttgatgcagataaagagtatctcaggcaaccacgggttattcgagttggcctg
attcagaactcaattgctattcctaccaccagtcattttgcagatcagaagaaggctatc
atggagaaagtcaagcctatgattgatgcagctggtgatgctggtgttaatattttgtgt
ttacaggaagcttggacaatgccttttgccttctgcacacgtgagaaaaggtggtgtgag
tttgctgagcctgttgatggagaatctactcaatttcttcaacaacttgctaagaaatat
aacatggtaattgtgagcccaatcctcgaaagagatgtaaaccacggagagattgtatgg
aatacagctgttgtcataggtaatcatgggaacataattggtatacatcgaaagaatcac
atcccaagagtcggtgatttcaatgagagcacatactatatggagggtaacactgggcat
ccagtgtttgaaacagcatatgggaaaatcggagtaaacatttgttatggaaggcatcat
ccccttaattggcttgcttttggcctcaatggagctgaaatagtattcaacccatccgca
actgttggtgaactcagtgaaccaatgtggcccattgaggccagaaatgctgcaattgca
aatagctactttgtcgggtcaattaaccgggttggcacagaggtcttcccaaacccattc
acttctggtgacgggaaacctcagcatgccgactttggtcatttctatggatccagccat
ttctcagcacctgatgcttcttgcaccccatcactatctcgctaccgagatggcttgatg
atatctgatatggacctcaacttatgtcgccagatcaaagacaagtggggcttccgcatg
actgcccgttatgacacgtatgcttccttgctttcagagtacttgaagccagattttaaa
cctcaagtcattgttgaccccttgatcaataagagtgcgtaa

DBGET integrated database retrieval system