KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343294
Entry
4343294           CDS       T01015                                 
Name
(RefSeq) NAD-dependent malic enzyme 62 kDa isoform, mitochondrial
  KO
K00028  malate dehydrogenase (decarboxylating) [EC:1.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4343294
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4343294
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.39  malate dehydrogenase (decarboxylating)
     4343294
SSDB
Motif
Pfam: Malic_M malic TPP_enzyme_C
Other DBs
NCBI-GeneID: 4343294
NCBI-ProteinID: XP_015647788
UniProt: B9FXC6 Q7F190
LinkDB
Position
7:18587319..18595397
AA seq 622 aa
MAAASISRSLLRRSRCGGGEHHLLLLARGFVTAECHRPVVLHKRGSDILHDPWFNRGTGF
SMTERDRLGLRGLLPPNVVSSQQQIDRFMLDMQRLQKYARDGPSDTYPLAKWRILNRLHD
RNETMYYKVLIDNIEEHAPIVYTPTVGLVCQNYSGLFRRPRGMYFSAEDRGEMMSMVYNW
PADQVDMIVVTDGSRILGLGDLGVHGIGIAIGKLDLYVAAAGINPQRVLPVMIDVGTNNE
KLLKDPLYLGLQEHRLEGEEYVAIIDEFMEAVFARWPNVIVQFEDFQSKWAFRLLQRYRK
TYRMFNDDVQGTAGVAIAGLLGAVRAQGRPMLDFPKQKIVVAGAGSAGIGVVNAASRTMA
RMLGNNEVAFESARSQFWIVDAHGLITEERTNIDPDARPFARRKSELGHQGLSEGASLVE
VVKKVKPDVILGLSAVGGLFSKEVLEALKDSSSSRPAIFAMSNPTKNAECTPEEAFSILG
EKIIFASGSPFSDVDLGNGKIGHSNQGNNMYLFPGIGLGTLLSGARVISDGMLQAAAERL
ASYMKEEEVLEGIVYPPISRIRDITKEVAAAVVKEAVAEDLAEGYRDMDARELARLSEEE
TVEYVQQNMWSPVYPTIVYKKD
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcggcggcgtccatctcgcggagcctcctccgccgatcccgctgcggcggcggggag
caccacctcctcctgctggcgcgcggcttcgtcacggcggagtgccaccgccccgtcgtg
ctccacaagcgcggctccgacatcctccacgacccatggttcaaccggggcacggggttc
tcgatgacggagagggaccgcctcggcctccgcggcctgctcccgcccaacgtcgtctcc
tcccagcagcagatcgaccgattcatgcttgacatgcaacggctgcagaaatatgcgaga
gatggcccatcggatacttacccgttagcaaaatggcgtatccttaacaggctgcatgac
agaaatgaaacaatgtattacaaggtcttaatagataatattgaggaacatgcacctatt
gtttacacgccgactgttggacttgtttgtcaaaactatagtggtttatttagacggcct
cggggaatgtattttagtgcagaagatcgtggggaaatgatgtccatggtgtacaactgg
ccagctgaccaggttgacatgatagtagtgactgatggaagcaggatattgggcctgggt
gatctcggggtgcatggtattggtattgccattggaaagttggatctatatgttgctgct
gctggaataaatccccagagggttcttccggtcatgattgatgtgggaacaaacaatgag
aagctcctcaaggatcctctgtatcttgggttacaagaacatcgtctggagggggaagaa
tatgtagcgattatcgatgaatttatggaagcggttttcgctcgctggccgaatgttatt
gtacagtttgaagatttccagagcaagtgggccttcaggttgttgcagcgttacaggaag
acttatcggatgtttaatgatgacgttcagggaactgctggcgttgctatagctggtctc
ttaggagctgtaagagcacaaggaaggccaatgttagatttcccaaagcaaaagattgtt
gttgcaggggctggcagtgctgggattggtgttgtgaatgctgcaagccggactatggca
aggatgctgggaaacaatgaggttgcttttgagagtgccaggagtcaattctggatagtc
gatgcccatggtctaataacagaggagcgcacaaacattgacccagatgcacggcctttt
gctaggagaaagagtgaactaggtcaccaaggcctaagtgaaggggcgagcttggttgaa
gtggttaaaaaggtgaagcctgatgtcatacttggattatctgctgttggtggtttgttc
tcaaaggaggttttagaagcattaaaagactcatcctcttcaagaccagcaattttcgcg
atgtcaaatccaactaagaatgctgaatgtacacctgaagaagccttttcaattcttggt
gaaaagatcatctttgccagtggaagcccatttagtgatgtggatcttggtaatggaaag
attggccactcaaatcaagggaataacatgtatctctttcctggaatagggcttggaacc
cttctatctggagcacgggttatctcagacggaatgcttcaggctgcagctgaacgcttg
gcttcgtatatgaaagaagaggaagttctcgaagggatagtataccctccaatctccaga
atacgtgatatcaccaaggaggtggcagcagcagttgtgaaggaagctgttgcagaggat
ctagctgagggatatcgtgacatggatgcacgtgaacttgcaagactcagtgaggaagaa
acagttgagtatgtccagcagaacatgtggagtccagtttatccaacaatagtgtacaag
aaagactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349051
Entry
4349051           CDS       T01015                                 
Name
(RefSeq) NAD-dependent malic enzyme 59 kDa isoform, mitochondrial isoform X1
  KO
K00028  malate dehydrogenase (decarboxylating) [EC:1.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4349051
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4349051
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.39  malate dehydrogenase (decarboxylating)
     4349051
SSDB
Motif
Pfam: Malic_M malic Pyr_redox_2
Other DBs
NCBI-GeneID: 4349051
NCBI-ProteinID: XP_015614456
UniProt: Q337E9 Q0IWK3
LinkDB
Position
10:19218572..19224002
AA seq 620 aa
MWRHAARRSSAQIRRSGVMSSSSSPAAPAAAAGAAVPGPCIVHKRGTDILHDPWFNKDTA
FPMTERDRLGLRGLLPPRVMSFEQQYDRFINSFRSLEHNTRGEPDTIVALAKWRILNRLH
DRNETLYYRVLIDNIKDFAPIIYTPTVGLVCENYSGLFRRPRGMYFSAKDKGEMMSMIYN
WPAEKVDMIVVTDGSRILGLGDLGVQGIGIPIGKLDVYVAAAGINPQKVLPIMLDVGTNN
TKLLEDKLYLGLRQPRLEGEEYLSVVDEFMEAVHARWPKAVVQFEDFQMKWAFETLQRYR
NRFCMFNDDVQGTAGVALAGLLGAVRAQGRPLSDFTKQKIVVVGAGSAGIGVLNMAKQAM
LRMPGINRSGEGHNQFWVLDKDGLITKSRKGLDPAVARYARGFGPEEVQDLHEGASLVEV
VRKVKPHVLLGLSGVGGIFNEEVLKAMKESDSPRPAIFAMSNPTTKAECTPEDVFKYVGD
NAVFASGSPFSNVTLGNGRQGYANQANNMYLFPGIGLGALLSGARHITDGMLQSAAECLA
SYITDDEIRKGILFPSISSIRHITARVGAAVVRAAVDEDLAEGRCDVDARDLKSMTEADT
VDFVARKMWYPIYSPLVNDK
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgtggcgtcacgcggcgcggcggtcgtcggcgcagatccggcggagcggggtcatgtcg
tcgtcgtcgtcgccggcggcccccgctgccgcggccggcgccgcggtgcccggcccctgc
atcgtccacaagcgcggcaccgacatcctccacgacccatggttcaacaaggacacggcg
ttccccatgacggagcgggatcgccttggcctccgcggcctcctcccgccgcgggtcatg
tcgttcgagcagcagtacgaccgcttcataaactcgttcaggtcgctggagcacaacacc
cggggagagcccgacaccatcgtcgcgctggccaagtggaggatcctcaacaggctgcac
gaccggaacgagacgctgtactacagagttctaattgacaatatcaaggatttcgcgccg
ataatatacactccgactgttgggttggtctgcgagaattacagtggcttgttcaggcgc
ccccgtgggatgtatttcagcgccaaggataagggggagatgatgtcgatgatttacaac
tggccagccgagaaggttgacatgatagttgtgactgatgggagccgtattctaggtcta
ggtgatcttggagttcagggcataggtatacctatcggtaaacttgatgtttatgttgcc
gctgctggtatcaatccacaaaaggttcttccaattatgcttgacgttggaacaaataac
acaaagcttctagaagacaagctatatttaggactgaggcaacctaggctggaaggagaa
gaatacttgtctgttgtagatgaattcatggaagctgttcatgcacgttggccgaaagca
gttgtgcagtttgaagacttccaaatgaaatgggcctttgaaactcttcagaggtatcgg
aaccgattttgtatgttcaatgatgacgtgcaggggacagcaggagttgctctagctggc
ctacttggagctgtgagagcacaaggtcgacccctctctgattttactaagcagaagata
gttgtggtgggagctggaagtgctgggataggtgtgcttaatatggctaaacaggcgatg
ctaaggatgccagggataaacaggagcggggaagggcataatcaattctgggttctggac
aaagatggacttattaccaaatccagaaagggcctggatcctgcagttgctcgctatgcc
agaggttttggtcctgaagaggtgcaagatctccatgagggggctagtcttgttgaagtg
gtcaggaaagtgaagcctcatgtgcttttaggactttctggagttgggggcatatttaat
gaggaggttctcaaggctatgaaagaatccgattcccctcgtcctgcaatttttgcaatg
tccaacccaactactaaagccgaatgtactcctgaagatgtattcaaatatgttggagac
aatgcagtatttgccagtggaagccctttcagtaatgtcactttaggcaatggtagacaa
gggtacgctaatcaagcaaacaatatgtatctgtttcctggtatcggtttaggagccctt
ctttcaggtgctcggcatattacagatggcatgctccaatcagcagctgagtgccttgcg
tcatacatcacagacgatgaaattcgaaaaggcatcctctttccatcaatctcaagtatc
aggcacatcaccgcacgtgtcggcgccgcagtcgtccgtgccgctgttgatgaagatctg
gccgaggggcgttgtgatgtagacgctagggacctcaagagcatgactgaggcggacaca
gtcgactttgtggctcggaagatgtggtaccctatttacagccccctcgtgaacgataag
tga

DBGET integrated database retrieval system