KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343339
Entry
4343339           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7
  KO
K12815  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX38/PRP16 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4343339
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4343339
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4343339
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Step II factors
    4343339
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD DUF2075 AAA_30 AAA_22 AAA_19 Flavi_DEAD AAA_24 T2SSE ABC_tran Sigma54_activ_2 AAA_14 AAA_7 AAA_16 AAA_33 SRP54
Other DBs
NCBI-GeneID: 4343339
NCBI-ProteinID: XP_015647213
UniProt: Q0D667 Q7XIR8
LinkDB
Position
7:complement(19290923..19299106)
AA seq 1280 aa
MEGDMDATMTTLGPEDDTGAQGLILPSRDRVMYRPPPGKSALGLDLLAHRKREAEGGNAF
KPPPQKVVAAATSIDEDEKPGPAESDEKSLSSGHRGSVSRRYRGANSDERTSFKEPTITD
EDGRGPSPSHRDGSYRQDTHKSRSSQGSHSRSTPRRYDDYEDRGSRDKHGERERSASIGY
SSSGRRGHHDDRESHNRRDERERSTSVDYMNKRSRHEHSSRSSRTPARSDWDSGRWEWED
TPRREYRDDRSNSHRQHPSPSPMLAAASPDARLVSPWLGGNTPRYAASPWDNVSPSPAPI
RASGSSKGSSYPRSGGRSHQLTFSSTSASNDRESDRSPSDADGNYEISEEMMQEMDYNAD
RAWYDCEEHNTMFDGDNSMYLEDDSSYKKREAQLPKRLTRKDGSLMTLAQSKKLSQMTAD
NAQWEDRQLLRSGAVRGTEVQTEFDDEDERKVILLVHDTKPPFLDGRVVFTKQAEPVMPL
KDPTSDMAIVARKGSALVREIREKQSMNKSRQRFWELAGSKLGNILGVEKTAEQVDADTA
TVGDQGEIDFKEEAKFSQHMKVKAEAVSDFAKSKSLSQQRQYLPIFTVRDDLLQVVRENQ
VVVVVGETGSGKTTQLTQYLHEDGYTTTGIVGCTQPRRVAAMSVAKRVSEEMETELGHKV
GYAIRFEDMTSPNTIIKYMTDGVLLRETLKDADLDKYRVIVMDEAHERSLNTDVLFGILK
KVVARRRDFKLIVTSATLNADKFSKFFGGVPVFHIPGRTFPVNIMFSKTPCEDYVEAAVK
QAMTIHITSGPGDILIFMTGQEEIEATCYALAERLEQLISSSTKTVPKLSILPIYSQLPA
DLQAKIFQKAEEGTRKCIVATNIAETSLTVDGIFYVIDTGYGKMKVYNPRMGMDALQVFP
VSRAAADQRAGRAGRTGPGTCYRLFTESAYQNEMLPNPVPEIQRTNLGNVVLLLKSLKVE
NLLDFDFMDPPPQENILNSMYQLWVLGALNNVGALTVIGWKMVEFPLDPTLAKMLLMGEQ
LECLDEVLTIVSMLSVPSVFFRPKDRAEESDAAREKFFVPESDHLTLLNVYLQWKSNQYR
GDWCNDHFLHVKGLRKAREVRSQLLDILKTLKIPLTSCHMEWDVVRKAICSAYFHNAARL
KGVGEYVNCRNGMPCHLHPSSALYGLGYTPDYVVYHELVLTTKEYMQCVTAVDPQWLAEL
GPMFFSVKETDTSLLDHKKRQKEDKTAMEEEMEKLRQEQAEAARLEKEREREKRAKQQQQ
VSMPGLKKGSTYLRPKRMGL
NT seq 3843 nt   +upstreamnt  +downstreamnt
atggagggggacatggacgcgacgatgacaaccctggggccggaggacgacacgggcgcg
caggggctgatcctgccgagcagggatagggtcatgtaccggccgccgccggggaagtcc
gccctaggtttggacctcctcgcgcacaggaaacgggaagcagaaggcggcaatgccttc
aagccgccgcctcagaaggtagtggcagctgctacttcaatcgatgaagatgagaagccg
ggacctgcggagagtgatgagaagagcctgagcagtggccatcgtggcagtgtttctcgc
cgctatcgaggagccaactctgatgagagaacctctttcaaagaacctaccatcactgat
gaggatggaaggggtccttcacccagtcaccgagatggatcttatcgacaagatacccac
aaatctagaagttctcaaggttcccattctcgtagcactcctcgtagatatgatgactat
gaggataggggatcccgtgataaacatggagaacgggaaagatctgcatccattggctat
agtagcagtggaaggcggggacaccatgatgatagagaatcgcataataggcgtgatgaa
cgtgagagatctacatccgttgactacatgaacaagcgaagtcggcatgagcatagctca
agaagctcaagaacacctgcaagatctgattgggacagtggccgatgggaatgggaagat
acacctcgtcgggagtaccgtgatgatcgctcaaattcccatagacaacatccttcacca
tctcctatgcttgcagctgcatcccctgatgcacgcttagtgtctccttggctaggtggg
aatacgccacgttatgcagcatccccatgggataacgtatctccatcacctgcaccaatt
cgcgcttctggttcatcaaaagggtcttcttatccacgttctggtggaagatcccaccag
cttactttttcgtctacatctgcatcaaatgacagggaatctgatagaagcccctcagat
gccgatggcaactatgagatatctgaagaaatgatgcaggagatggattataatgctgat
cgtgcgtggtatgattgtgaagaacacaacaccatgtttgatggtgataattctatgtat
cttgaagatgatagttcctacaaaaagagggaagcacaattaccaaagcggctgactcgt
aaagatggcagtctgatgacccttgctcagagcaagaagttatcacagatgactgctgat
aatgctcaatgggaggatagacagttgttgagatctggagctgtcagaggaacagaggtg
cagacagaatttgatgatgaggacgaaaggaaagtaatacttcttgttcatgacacaaaa
cccccattcctggatgggcgagttgtattcacaaaacaagcagaacctgtaatgccactg
aaggacccaacctccgatatggcaatagttgcacgcaaaggttctgctttggtcagggaa
attcgtgaaaaacagagcatgaataagtcacgccaacgcttttgggagctcgctggatct
aagcttggaaatattttgggtgttgagaaaacggctgaacaggttgatgcagatactgct
actgttggtgaccaaggtgagattgattttaaagaggaagcaaaattttcacagcacatg
aaggtaaaagcagaagctgttagcgactttgcaaaatcaaaatctctttctcaacagagg
caatatcttccgatatttactgtacgggatgacttgctacaggttgtgcgtgaaaatcaa
gtagttgtggtggttggtgaaactggctctgggaagactacccagctgactcagtatctg
catgaggatggatataccaccaccggcattgttggctgtactcaacctagacgtgtggct
gccatgagtgttgctaaaagagttagtgaagaaatggagactgagttgggacataaagtt
ggatatgcaattcgatttgaggacatgactagtcccaacactataataaagtatatgaca
gatggagtgctgcttcgggaaaccttgaaagatgctgaccttgacaaatatcgtgttatt
gtcatggatgaagcacatgagagatcactcaatactgatgttttgtttggcatactgaag
aaggttgttgcacgtcgacgagattttaagctaattgtcacatctgcaaccctaaatgcg
gacaaattctcaaaattttttggaggagtgcctgtcttccatattcctggcaggacattt
cctgtaaatatcatgttcagcaaaacaccatgtgaagactatgtggaagcggcagtgaag
caggctatgacaatccacataaccagtggccctggggatatacttatatttatgacaggg
caagaggaaattgaggctacctgctatgcgcttgctgagcgcctggagcagctgatatca
tcatccaccaagactgtacccaagctctccatcttgcccatctactcgcagttgcctgct
gacctgcaggccaaaatctttcagaaggcagaagagggcactcgcaaatgcattgttgct
accaacattgctgagacctcgctcactgtggatggtattttttatgtcattgatactggg
tatggaaagatgaaggtgtacaatccacggatgggtatggatgctcttcaggtttttcca
gttagtcgagcagctgcagatcagcgtgcaggacgtgcaggaagaactggtcctggcaca
tgctacagactgttcacagaatcagcttaccagaatgagatgctacctaacccagtgcct
gagatccaaaggaccaatctggggaatgtggttctgctactgaaatctctgaaagtcgaa
aacttgcttgactttgacttcatggacccacccccgcaggagaacatcctcaactccatg
taccagctctgggtgttgggtgccttgaacaatgttggtgctcttacagtaataggttgg
aagatggttgaattcccgttggacccaactctagcaaagatgcttctcatgggagaacag
ctggagtgccttgatgaagtactgaccattgtgtcaatgctctcggtgccctcagtcttc
tttcgtcccaaagatcgagcagaggagagtgatgcagcaagggagaaattttttgttcca
gaatctgatcatttaactcttctgaatgtctacctgcaatggaagtcgaaccaatatcgt
ggagactggtgtaatgaccacttcctccatgtcaagggtctccgaaaggctcgagaagta
aggtcacagctattggacatactgaaaaccctgaagatcccactgacatcatgccatatg
gaatgggatgtggtgagaaaagccatctgctctgcatacttccataatgccgcgaggttg
aagggtgtcggggagtatgtgaactgccggaacgggatgccatgccacctccaccccagc
agtgcactctacggccttggttacacccctgactatgttgtctaccatgagcttgtcctg
acgaccaaagagtacatgcagtgcgtcaccgctgttgacccgcagtggctggcagagttg
ggccctatgttcttctctgttaaggaaaccgacacctcgctcctcgaccataagaagagg
cagaaggaggacaagaccgcgatggaggaggagatggagaagctgaggcaagaacaagcc
gaggccgcacggcttgagaaggagagggagcgagagaagagagctaagcagcagcagcaa
gtttctatgccgggcttgaagaaaggctcgacatacttgaggcccaaaaggatgggtcta
tag

DBGET integrated database retrieval system