KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343441
Entry
4343441           CDS       T01015                                 
Name
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4343441
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     4343441
SSDB
Motif
Pfam: ICL PEP_mutase
Other DBs
NCBI-GeneID: 4343441
NCBI-ProteinID: XP_015644942
UniProt: Q6Z6M4 A0A0A0QMT5
LinkDB
Position
7:complement(20691105..20693689)
AA seq 572 aa
MSSPFSVPSLIMEEEGRFEAEVAEVEAWWGTDRFRLTKRPYTARDVALLRGTLRQSYASG
DMAKKLWRTLRAHQANGTASRTFGALDPVQVAMMAKHLDTVYVSGWQCSSTHTSTNEPGP
DLADYPYDTVPNKVEHLFFAQLYHDRKQREARMSMSRAERAHEPYVDYLKPIIADGDTGF
GGATATVKLCKLFVERGAAGVHLEDQSSVTKKCGHMAGKVLVAVSEHVNRLVAARLQFDI
MGVETVLVARTDAVAATLIQTNVDARDHQFILGATNPRLRNRSLAAVLSDAMSAGKNGRE
LQAIEDEWLATAQLKTFSDCVRDAIASLNATDADKQRKLQEWSAATSHDKCVPLEQARDI
AAGLGVTSLFWDWDLPRTREGFYRFRGSVAAAVVRGRAFAPHADVLWMETSSPNIAECTA
FAEGVRAASPGAMLAYNLSPSFNWDASGMTDADMSEFIPRVARLGYVWQFITLAGFHADA
LVTDTFARDFARRGMLAYVERIQREERSNGVETLQHQKWSGANFYDRVLKTVQGGISSTA
AMGKGVTEEQFKGSWTGPGSESSSHVLAKSRM
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgtcgtcgccgttctccgtgccatctctgatcatggaggaggaagggcggttcgaggcg
gaggtggcggaggtggaggcgtggtggggaacggacaggttccggctcaccaagcgcccc
tacacggcgcgcgacgtcgcgctcctccgcggcacgctccggcagagctacgcctccggc
gacatggccaagaagctgtggcgcacgctcagggcgcaccaggccaacggcacggcgtcg
cgcaccttcggcgcgctcgaccccgtccaggtcgccatgatggcgaagcacctcgacacc
gtctacgtctccggatggcagtgctcgtcgacgcacacctcgacgaacgagccgggcccc
gacctcgccgactacccctacgacaccgtccccaacaaggtcgagcacctcttcttcgcc
cagctctaccacgaccgcaagcagcgggaggcgcgcatgtcgatgtccagggcggagcgc
gcgcacgagccgtacgtggattatcttaagcccatcatcgccgacggcgacaccgggttc
ggcggcgccacggccaccgtcaagctgtgcaagctgttcgtcgagcgcggggcggccggg
gttcacctcgaggaccagtcgtcggtgaccaagaagtgcgggcacatggcggggaaggtg
ctcgtcgccgtctccgagcatgtcaaccgcctcgtcgccgcgcggctccagttcgacatc
atgggcgtcgagaccgtcctcgtcgcgcgcaccgacgccgtcgccgccacgctgatccag
accaacgtcgacgcgcgcgaccaccagttcatcctcggcgcgaccaacccgcgcctcagg
aaccggagcctcgccgccgtcctctccgacgccatgtcggcgggcaagaacggcagggag
ctccaggccatcgaggacgagtggctcgccacggcgcagctcaagaccttctctgactgc
gtcagggacgccatcgcgagcctcaacgccaccgacgccgacaagcagcgcaagctccag
gagtggagcgccgccaccagccacgacaagtgcgtgcccctcgagcaggcgcgcgacatc
gccgcgggcctcggcgtcacatccctgttctgggactgggacctgccgagaacacgggag
gggttctaccgcttccgcggctccgtcgcggcggccgtcgtccgcggccgcgcgttcgcg
ccgcacgccgacgtgctctggatggagacgtcgagccccaacatcgccgagtgcacggcg
ttcgccgagggcgtgagggcggcgagcccgggcgcgatgctggcgtacaacctctcgccg
tccttcaactgggacgcctccggcatgacggacgccgacatgtcggagttcatcccgcgc
gtggcgaggctggggtacgtgtggcagttcatcacgctcgccgggttccacgccgacgcg
ctcgtcacggacacgttcgcccgcgacttcgcgcggcgcggcatgctggcgtacgtggag
aggatccagagggaggagaggagcaacggcgtggagacgctgcagcaccagaagtggtcg
ggcgccaacttctacgacagggtgctcaagaccgtgcagggtggcatctcctctaccgcc
gccatgggcaaaggagttactgaagagcagttcaagggctcatggacagggcctggaagt
gagagcagcagccatgttcttgccaaatccaggatgtga

DBGET integrated database retrieval system