KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343535
Entry
4343535           CDS       T01015                                 
Name
(RefSeq) probable proteasome inhibitor isoform X1
  KO
K06700  proteasome inhibitor subunit 1 (PI31)
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4343535
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4343535
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4343535
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PI31
    4343535
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4343535
SSDB
Motif
Pfam: PI31_Prot_N PI31_Prot_C
Other DBs
NCBI-GeneID: 4343535
NCBI-ProteinID: XP_015644726
UniProt: B7F961
LinkDB
Position
7:complement(21788528..21793872)
AA seq 292 aa
MVTDAAAMAVVKAARPAFRGAHDGVAFAANAAFLAAGYSLCAVGPAALTDPPPSGEEEVG
IDGWNSMDNCYAFLYIKEERGKKKRVLVKCLVIGDVLAIDVLDLESQNKGPYNIQINVKD
FFSEEQPKNYGNMYKNFAGLIETMNSNALSKLDEKDAGAAKNPEVETSSSIHRSENPGLR
TTEPGLVYPPIAPLGHDDAFPGPGAGFYPHSGIGGGGSMHVGPNDPRFFPSNPFPVPFGG
PGSVPPGGRYDPIGPPDVPGFEPSRFVRRPRPPAGTTHPDLEFFQPGPHGPF
NT seq 879 nt   +upstreamnt  +downstreamnt
atggtgaccgacgccgccgcgatggccgtcgtgaaggcggcgcgcccggccttccgcggc
gcccacgacggggtcgccttcgccgccaacgccgcgttcctcgccgccggctactccctc
tgcgccgtcggccccgccgcgctcaccgaccccccgccctcaggtgaagaggaggtgggg
attgatggttggaacagcatggataattgttatgcatttttgtacatcaaggaggagagg
ggcaagaagaaacgggtattggtaaaatgtctggtgatcggtgatgtccttgccattgat
gtcctggatcttgagtcacagaataaaggcccttataatatccagatcaatgtgaaggat
ttcttctccgaggagcagccaaagaactatgggaacatgtacaaaaactttgcaggctta
attgagaccatgaactcaaatgcattgagcaaattggatgagaaggatgctggtgctgcc
aagaaccctgaggttgagactagctcatcaatacacagatctgaaaatccaggcctgaga
actactgaacctggcttggtttatcctccaatagctccacttggtcatgatgatgccttc
cctggccctggcgcaggcttctatcctcatagtggtattggtgggggtggcagcatgcat
gttggtccaaacgatccacgcttctttccttctaatcccttccctgtgccctttggtggc
cctgggagtgttccaccaggtggtcgttatgatccaattggtccaccagatgttccagga
tttgaaccttctcgctttgtgaggcgtccgaggcctccagctgggactactcacccagac
cttgagttcttccagccggggccgcacgggcccttctga

DBGET integrated database retrieval system