KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344059
Entry
4344059           CDS       T01015                                 
Name
(RefSeq) xylulose kinase
  KO
K00854  xylulokinase [EC:2.7.1.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4344059
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     4344059
SSDB
Motif
Pfam: FGGY_C FGGY_N
Other DBs
NCBI-GeneID: 4344059
NCBI-ProteinID: XP_015647798
UniProt: A3BMP1 Q8GRU7
LinkDB
Position
7:26640735..26645366
AA seq 562 aa
MVGRSSLPEGSLFLGFDSSTQSLKATVLNNELIIVASDIVNFDSDLPHYKTEGGVYRDPA
DDGHIFSPTIMWVEAFELLLEKLKPKINFSKVVAISGSGQQHGSVYWKKGSHAVLSSLDP
TKSLLSQLKDAFSTMDSPIWMDSSTTKQCREIESVVGGALELSKLTGSRAYERFTGPQIR
KIYRTVPQVYDDTERISLVSSFMASILVGNYASIDETDGAGMNLMDINQRTWSKTVLEAT
APGLEEKLGKLAPAYAVAGRIAPYFVERLQFDKNCLVIQWSGDNPNSLAGLTLNTPGDLA
ISLGTSDTVFGITAEAKPSLEGHVFPNPVEPDGYMVMLCYKNGSLTREDVRNSCAEKSWD
VFNSYLEKTPPLNGGKLGFYYKDHEILPPLPVGFHRYIVENLNDVTSNNLVEREVEEFDP
PSEVRAIIEGQLLSMRGHAERFGMPNPPKRIIATGGASSNERILHSIAQIFGCPVFTVQR
PDSASLGAALRAAHGWLCNEEGSFVPISCMYQGNLEKTSLGAKLAVSTGEGVEDKELLEK
YTVLMRKRMEIERRLVEKIGRA
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggtggggcggagctccctcccggagggttccctcttcctcggattcgacagctccact
cagtccctaaaagctaccgtgctgaacaacgaattgataatagtagcttcagatattgtt
aactttgattctgacttaccgcactacaaaacagaaggtggtgtttacagagatcctgca
gatgatggccacatattttcaccaacaataatgtgggttgaagcctttgaattgctactt
gagaagctaaagccaaagatcaactttagcaaggttgtggccatttcagggagtgggcaa
caacacggcagtgtttattggaagaagggtagtcatgcggtgttgtcttccttggatcct
actaagagcttgttatcccagctgaaggatgccttttctaccatggactcaccaatatgg
atggacagtagcacaactaagcaatgcagagaaatagaaagtgtagtaggcggcgcattg
gagctatcaaagttgacaggatctcgtgcctatgagaggttcactgggcctcagatccgg
aagatataccgaacagttccgcaagtttatgatgatactgagagaatatctttggtgagt
tcgttcatggcatcaatcctggtggggaactatgcaagtattgatgagactgatggtgct
gggatgaacttgatggatataaaccagagaacctggtcaaagactgttttagaggcaacg
gctcctgggcttgaagagaagcttggaaagttggcaccagcatatgcagtagctggtcga
attgctccttattttgtagaaaggcttcagtttgataagaattgcttagttattcaatgg
tctggagacaatcccaatagccttgcaggtttaactctgaatactcctggtgaccttgca
attagccttggtactagtgatactgtttttgggataactgctgaagctaaaccaagtctt
gaaggccatgttttccctaaccctgttgaacctgatggttatatggtgatgctgtgctac
aaaaatggttcattgacccgagaagatgtgcggaacagttgcgcggagaaatcctgggat
gttttcaacagttatctagagaaaactccacctctaaatggcggaaaattaggattctac
tacaaagaccatgaaattctgccgccacttccagttggcttccatcgatacattgttgaa
aacctcaatgatgtcacatccaacaatctggtggaacgtgaggtggaagaatttgatcca
ccatctgaggttcgcgccataatcgaaggccagctgctgtcaatgcgaggccatgccgag
agattcggcatgcctaaccctcccaagcggatcatcgcaaccggtggcgcatcctccaac
gagcgcatcctccactcaatcgcgcagatctttggctgtcctgtctttacagttcagaga
cctgattctgcctcgcttggcgcggcactgagagctgcccatggctggctgtgcaatgag
gaagggagcttcgtccccatctcctgcatgtaccagggtaacctggagaagacctccttg
ggtgcaaagctcgccgtctcaaccggagagggtgtggaggacaaggagctcctggagaag
tacacggtgctcatgaggaagaggatggagattgagaggcggctggtggagaagattggg
cgcgcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352874
Entry
4352874           CDS       T01015                                 
Name
(RefSeq) xylulose kinase isoform X1
  KO
K00854  xylulokinase [EC:2.7.1.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4352874
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     4352874
SSDB
Motif
Pfam: FGGY_C FGGY_N
Other DBs
NCBI-GeneID: 4352874
NCBI-ProteinID: XP_015618274
UniProt: A0A0P0YD07
LinkDB
Position
12:complement(27128026..27131959)
AA seq 570 aa
MAMAADGDHCRLPDDSLFLGFDCSTQSLKATVLDAGLTAVAHDAVHFDSDLPHYATHGGV
LRDPSGGDPGRVVSPPLMWAEALDLLLARLAPRVDYARVAAVSGGAQQHGSVYWKRGAAA
VLASLDPARGLAPQLAAALATTESPVWMDSSTAAQCREVEAAVGGALELARMTGCRAHER
CTGPQIRKMYQARRRVYDDTERISLVSSFMASLLVGGYACIDETDGAGMNLMDITTRELR
RDALEATAPDLEDKIGKLAPAHAVAGTLSPYFVQRFQFSSNCLVVQWSGDNPNSLAGLTL
SDPGDLAISLGTSDTVFGITDLPEPSLDGNILPNPVDPKTYMVMLCYKNGSLTREDVRNR
YADGSWDVFNKHLENTAPLNGRKLGYYYNEPEILPPLPVGFHRYVVSSSASGSLDEMVEH
QINQFDPPSEVRAIIEGQFLSMRGHAERCGLPVPPKRIIATGGASSNQIILKTMASIFGC
SVYTVQRPDSASLGAALRAAHGWICNQKGKFVPVSCLHSDRLNRTSLSIKLAAPFGDSEE
DIDLLNNYTLLMKKRLEIEQKLVEKFGRHS
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggccatggcggctgatggtgatcactgccgcctccccgacgactccctcttcctcggc
ttcgattgctccacgcagtcgctgaaagccacggtgctggacgccggcctcaccgccgtc
gcccacgacgccgtccacttcgactccgacctgccgcactacgccacccatggcggcgtc
ctccgggacccatccggcggcgacccgggccgcgtcgtgtcgccgccgctcatgtgggcc
gaggcgctggacctgctgctcgccaggctcgcgcccagggtggactacgcccgcgtcgcc
gccgtctccggcggcgcgcagcagcacggcagcgtctactggaagcgcggcgcggcggcg
gtgctcgcgtccctcgacccggccaggggcctggcaccgcagctcgccgcggcgctcgcc
acgacggagtcgccggtgtggatggacagcagcacggcggcgcagtgccgggaggtggag
gcggcggtcggcggcgcgctggagctggccaggatgaccgggtgccgcgcgcacgagcgg
tgcacaggcccgcagatcaggaagatgtaccaggcgaggcggcgcgtgtacgacgacacc
gagaggatctcgctcgtgagctcgttcatggcgtcgctgctcgtcggcggctacgcctgc
atcgacgagaccgacggcgcggggatgaacttgatggacatcaccacgcgcgagttgcgc
agggacgcccttgaggctactgctcctgatttagaagacaagattgggaagctagcaccg
gcgcatgctgttgcaggaactttatctccttatttcgttcagagatttcagttttcaagc
aactgtctagttgttcagtggtcaggggacaaccccaacagccttgcaggtttaactttg
agcgatcctggtgatctagcaatcagtcttgggacaagtgatacagtttttgggataact
gatttacctgaaccatccctggatgggaacatcctccctaacccagtggaccccaagaca
tatatggttatgctttgctacaaaaatggctctctaacacgggaagatgtccgcaatcgt
tatgctgacgggtcatgggatgtgttcaacaagcatttggagaatacagctcctttaaat
ggaagaaaattgggatattactacaatgagcctgagattctgccaccacttccagttggg
tttcaccgttacgttgtcagctcctcagccagtggatctttagatgagatggtggagcat
cagataaaccagtttgatcctccttcagaagtccgtgcaataatagaagggcagttcctg
tccatgaggggccatgctgaaaggtgtggtctgccagtgcctccaaagcggattatagcg
accggtggagcatcgtcgaaccagatcattctcaagacgatggcatccatttttggctgc
tcggtttacaccgtccaaagaccagactctgcctcactgggtgctgctcttagagcagcc
catgggtggatttgcaaccagaaaggcaagtttgtgcctgtttcatgtctgcactcggac
agactgaatagaacatcactaagcattaagctggctgctccatttggagactcggaggag
gacattgaccttctgaacaactacacgttgttgatgaagaaaaggctggagattgaacag
aagcttgtcgagaagtttggtcgacattcatga

DBGET integrated database retrieval system