KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344180
Entry
4344180           CDS       T01015                                 
Name
(RefSeq) UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4344180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4344180
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     4344180
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4344180
SSDB
Motif
Pfam: Glycos_transf_4
Other DBs
NCBI-GeneID: 4344180
NCBI-ProteinID: XP_015647599
UniProt: Q0D3X4 Q7EZZ0
LinkDB
Position
7:complement(27868915..27876644)
AA seq 430 aa
MDARRRPAATAAAAAAAPADAQPRARPAAAVAAAEAADAELVLRAPNLRVVAAAMVAFLA
PFSYLAFVHYPLDAALRRSILICGAMSFGGFVVVLRLVPVAARYLLRRGMWGKDINKRGL
PMGEIRVPEALGIVVGIVYLVIAILFQHFNFTADSMWLVEYNAALASVCFMVLLGFIDDV
LDVPWRVKLLLPTIAALPLLMAYAGGTSVSIPKPLTSYVGVAVLELGSLYKLFMLLLAVF
CTNSINIHAGLNGLEVGQTVIISAAVLIHNVMRIGSSTDIEAQQAHAFSIYLVLPFLTTS
LALLAFNWYPSSVFVGDTYTYFSGMALAVVGILGHFSETLLLFFLPEVLNFLCSVPQLFK
FVPCPRHRLPRFDPHTGLLTGTKDGNLVNIFLRIFGRCTERTLCIRLLIFQALSCLFCFW
LRYMITGWYK
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggacgcccgccgcaggcccgcggcgacggcggcggcggcggcggcggcacccgctgat
gcgcagccgcgggcgaggccggctgctgcggtggcggcggcggaggccgcggatgctgag
ctggtgctccgggcgccgaacctgcgcgtggtcgccgcggcgatggtggccttcctcgcg
cccttctcgtaccttgcgttcgtgcactacccgctggacgcggcgctgcggcgatccatc
ctcatctgcggggccatgagcttcggcggcttcgtcgtcgtgctccgcctcgtccccgtc
gccgcacgctacctcctccgtcgcgggatgtgggggaaggacatcaacaagcgcggcttg
cccatgggcgagatcagagtgcctgaggcacttggcattgttgttgggattgtctacttg
gtcattgctattctatttcaacatttcaacttcacagcagactctatgtggcttgttgaa
tacaacgcggcactagcatcagtctgctttatggtgcttcttggatttattgatgatgtt
cttgatgttccatggagagtgaaacttctactacccacaattgcagcacttcctttgctg
atggcatatgctggtggtacttccgtcagcattccaaagcctctaacatcttatgttgga
gtagctgttctggagctaggttctctgtacaagctctttatgctcctattagcagtcttt
tgtacaaattcgatcaatatacatgctggcctgaatggtcttgaagttgggcagacagtt
attatatctgctgcggttttgatacataatgtaatgcgcataggatcttctacggacatt
gaagcgcaacaagcccatgcattctcgatttatcttgtcctgcctttcttgaccacttca
ttagctttgctcgcatttaactggtatccttcatctgttttcgttggtgatacctacacc
tatttttctggaatggcattggctgtggtgggaattttgggtcatttcagcgagacatta
ttgctcttctttttacctgaggttcttaactttctgtgctcagtcccacagctgtttaag
tttgttccctgcccaaggcacaggttgccaaggtttgatccccacacaggactgttgacg
ggtaccaaagatggtaacttggtaaacatattccttaggatatttggaagatgcacagag
aggaccctttgcataaggctgctcatatttcaggcgttgtcatgcctattctgcttttgg
ctgaggtacatgattactggatggtacaaatga

DBGET integrated database retrieval system