KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344267
Entry
4344267           CDS       T01015                                 
Name
(RefSeq) probable acyl-CoA dehydrogenase IBR3
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4344267
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4344267
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     4344267
SSDB
Motif
Pfam: APH Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_dh_N Choline_kinase EcKL
Other DBs
NCBI-GeneID: 4344267
NCBI-ProteinID: XP_015647096
UniProt: Q6ZDX3 Q69J84
LinkDB
Position
7:28552611..28559018
AA seq 831 aa
MLTSGLLRPVDDAHAIDEAALLRYAAEHVAGFPSPARGLALTQFGHGQSNPTYCIEASAP
GGVTARYVLRKKPPGAILQSAHAVEREFQVLKALGTYTDVPVPKVFCLCTDASVIGTPFY
IMEHLEGLIYPDNKLTGVTPTKRKTIYLAAAETLAAIHKVDVTAIGLQKYGRRDNYCKRQ
VERWGRQYLSSTGEGKPARYQKMLDLAHWLKEHIPKEDSSAGFGTGLVHGDYRVDNLVFH
PTEDRVIGVLDWELSTLGNQMCDVAYSSLPYIIDATTSTGYSYGGFEYTGIPDGIPPLEE
YLAAYCSISARPWPAASWKFYVAFSLFRGASIYAGVYHRWTMGNASGGERARFSGKIANA
MVDRAWDIINRENVLREQPARGMHASNGPSQEFQRKHEGSISTKDQGKFVPSEKVMQLRN
KLMKFMEDYIYPMESEFYKRAHSTSRWTIHPEEEKLKALAKREGLWNLFIPLDSAARARE
LLFEDMSHGSPGSSEELLLGAGLTNLEYGYLCEIMGRSIWAPQIFNCGPPDTGNMEVLLR
YGTKEQQKQWLVPLLEGKIRSGFAMTEPQVASSDATNIECSISRQGDFYVINGTKWWTSG
AMDPRCQILVLMGKTDFSAPKHKQQSMILVDVKTPGVQIRRPLLVFGFDDAPHGHAEITF
ENVRVPATNILLGEGRGFEIAQGRLGPGRLHHCMRLIGAAERGMNLMVERALSRTTFGKK
IAQHGSFLADLAKCRVELEQARLLVLEAADQLDRHGNKKARGILAMAKVAAPNMALKVLD
MAMQVHGGAGLSSDTVLSHLWATARTLRIADGPDEVHLGTIAKLELQRARM
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgctgacctcggggctgctgcggccggtcgacgatgcgcacgcgatcgacgaggcggcg
ctgctgcgctacgcggcggagcacgtcgccgggttcccctccccggcgcgggggctggcc
ctgacgcagttcggccacggccagtccaaccccacctactgcatcgaggcctccgccccc
ggcggggtcaccgcgcgctacgtgctgcggaagaagccgcccggcgccatcctccagtcc
gcccacgccgtcgagcgcgagttccaggtcctcaaagctttgggcacttacactgatgtt
cctgtccctaaggtgttctgtctttgcactgatgcaagtgtaattggaactcctttctat
ataatggagcatctagaaggactaatatacccagacaacaagttgacgggagtaactcca
actaaaagaaagactatatatcttgcagctgctgaaactttggctgctatacacaaagtt
gacgtgactgcaattggactgcagaagtatgggagaagagataactattgcaaaagacaa
gtagaaagatgggggaggcaatatctctcttccactggtgaagggaagcctgctcgttac
cagaagatgcttgatctagctcattggttgaaagaacatataccaaaagaagattcatcg
gcaggatttggaacaggtcttgttcatggtgattaccgtgttgataatcttgtttttcat
ccaacagaggaccgagttattggtgtacttgattgggaactatctactttgggtaatcaa
atgtgtgatgttgcatacagctctttgccgtatattattgatgcaacaactagtacaggt
tattcttatggtggatttgaatatactggcattccagatggcattcccccactggaagag
tacctcgctgcatactgctctatctctgcaagaccctggccggctgcaagttggaagttt
tatgttgccttttcgctttttcgaggggcatctatatatgcaggagtatatcacagatgg
actatgggtaatgcttcaggtggtgagcgtgctagattttctggcaagattgctaatgct
atggttgaccgtgcctgggatatcataaatagagaaaatgtcctgagagaacagcctgct
aggggtatgcatgcctcaaatggcccatcgcaagaattccaaagaaagcatgaaggatca
atttcgacaaaagatcaaggaaaatttgttcctagtgaaaaggttatgcagcttcgaaac
aaattgatgaagtttatggaagattacatatacccgatggagagtgagttctataaacgc
gcacattcgacctcaaggtggacaattcatccagaagaagaaaaactaaaagccttagca
aagagagagggactatggaacttgtttattccgctagacagtgctgctagagcaagagag
cttctgtttgaggacatgtctcatggttctcctggaagttctgaggagcttttgctaggt
gcaggtctcacaaatcttgaatatggatatctatgtgagattatgggccgttcaatttgg
gctccacaaatatttaactgtggtccacctgatacaggcaacatggaggtcctgttgaga
tatgggactaaggagcaacaaaagcagtggcttgttcctttgttggaagggaaaattcgt
tctggatttgcaatgacagaaccacaagttgcatcttcagatgcaacaaacatcgagtgt
tcaatatcaaggcaaggagatttctatgtgataaatggaacgaaatggtggaccagtggg
gctatggatccaaggtgccaaattcttgtattaatggggaagacagatttttctgcacct
aaacataaacagcaatcgatgattttagttgatgtcaaaacacctggagtgcagataagg
agaccgttgttagtatttggtttcgatgatgcacctcatgggcatgcagagattactttt
gagaatgtgcgcgttccagccacaaatattctccttggggaaggccggggttttgagatt
gctcagggaagactaggccctggaagattacatcattgcatgagactaataggggcagca
gaacgtggcatgaatttgatggtcgagagggccttaagtaggaccacttttggaaaaaag
attgcgcaacatggttcctttttagcagatctggcgaagtgccgggtagaactggagcag
gctagacttctggtgcttgaagcagccgatcaacttgaccgacatgggaacaagaaagct
cgtggtatccttgcaatggccaaggtggcagctccaaatatggccctgaaagtgcttgac
atggcaatgcaagttcatggtggtgctggtctctcatcagacacagttctatcacatcta
tgggcaactgctaggacactgaggatcgccgacggccctgatgaagttcatcttgggaca
atcgctaagctggagctgcaaagagcaaggatgtag

DBGET integrated database retrieval system