KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344306
Entry
4344306           CDS       T01015                                 
Name
(RefSeq) probable ATP-dependent DNA helicase RecQ isoform X1
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:5.6.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4344306
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4344306
   03400 DNA repair and recombination proteins [BR:osa03400]
    4344306
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     4344306
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     4344306
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      4344306
SSDB
Motif
Pfam: Helicase_C RQC DEAD HTH_40 HRDC RecQ_Zn_bind ResIII
Other DBs
NCBI-GeneID: 4344306
NCBI-ProteinID: XP_015645652
LinkDB
Position
7:28901449..28908684
AA seq 889 aa
MEAALKTYFGFSGFRSYQREIIQKVLEGRDCLVVMATGSGKSICYQIPPLVTKKTAVVVS
PLLSLMQDQVMSLKQHGVKSEYLGSTQTDISVSGQAEKGAFDVLYMTPEKAVSLPSRFWS
NLQAAGICLLAVDEAHCISEWGHDFRTEYKQLHMLRDLLVGVPFVALTATATQRVRGDIA
TSLTLRIPHIVVGSFDRPNLFYGVKSCNRSMAFINELVKDVSKNCTVGGSTIIYCTTIRE
TEQVHEALVAAGIKSSIYHGRMGNKAREESHRSFVRDEVLVMVATIAFGMGIDKPDVRCV
IHYGCPKSLESYYQESGRCGRDGLPSVCWLYYQRSDFMKSDFYCAEAKSQTHRKAIMESF
MAAQKYCLLATCHRKFLLQYFGEDRTTDCGNCENCTRTKNERDLSKESFLLLSCIKSCGG
RWGLNLPIDVLRGSRVKKIVENNFDKLPLHGRGKDYPPNWWKALGGLLLAHDYLKETVHD
TFRSISVSPNGYKFLSTADKGDGASLFLQLTAEMIELEGHGGSQCKEEGLNPLGPSESEK
ISEDELKIYQVLLNVRMQLAQDIGTAPYAICGDQTLRNFAKFRPSTIARLANIDGVNQHF
ISHYGSIFIQNITQLAKELNLPVDDLSAVESIPAAPKPTQNNLPRSLGGAKFCSWELWQK
MKFSFQKVAHYRRAVPIKEKTVISYILDAARDGCEMDWSRFCEEVGLTHEIASQIRLAIT
KLGSHEKLKPIKDELPENVTYEMIQTFLAIEGLGLSDQVFGTVPTDGIQSKTSEAPKTTS
NGGEVGADVCDASPLTRRGQTDGSLICGDEPASKLQKIDGQGVNSTAAIGATEDAILELV
EGRNGLLQVSLEDVVKHFNGSKRECVVEMLDNLEGNFLVYKKNGCYMIM
NT seq 2670 nt   +upstreamnt  +downstreamnt
atggaggcagctctgaagacgtatttcggcttctcggggttccgttcgtaccagcgggag
atcatacagaaggtcctggaaggccgggattgcttggtcgtcatggccaccggcagcggc
aagtcgatctgttatcaaatcccaccacttgttacaaagaagacagctgttgttgtcagc
cctcttctgtcattgatgcaagaccaggtcatgagcttaaagcagcatggcgtgaagtct
gaataccttggcagcacccaaacagacatctctgttagcggtcaggctgaaaaaggcgca
ttcgatgttctgtacatgacaccagagaaagctgtctcacttccttcaaggttttggagt
aacttgcaggctgccggaatctgcttgttggctgtcgatgaagcacactgcatatcagaa
tggggccacgatttcagaacggagtacaaacagttgcatatgttgcgtgaccttctagtg
ggtgttccctttgtcgctttaactgcaacagccacacaaagggtacgtggagacattgcc
acttccttgaccctgcgcattcctcacattgtggtaggatcatttgatcgtcctaacctt
ttctatggcgtgaaatcatgcaaccggtctatggcctttatcaatgaacttgtgaaggat
gtctcaaagaactgtactgtgggtggctcaacaataatatactgtactaccatccgagag
actgaacaggtgcatgaggcattggttgctgctggaatcaagtccagcatttaccatggt
agaatgggaaataaagctagagaggaatcacatagatcgtttgttagagatgaagtactt
gtgatggtggctaccattgcttttggaatgggaatcgacaagccagatgttagatgtgta
atacattatggatgtccaaagagcctggaatcctactaccaggaaagtgggcgttgtgga
agagatggactgccttcagtctgctggctatattaccaaagaagtgattttatgaaatct
gatttctattgtgctgaagctaaaagtcaaactcatcgaaaagccatcatggagtccttc
atggcagcacaaaaatattgcctgcttgctacatgtcacagaaaattcttgctgcagtac
tttggcgaagaccgcaccactgactgtggtaattgtgaaaattgcacaaggacaaaaaac
gagagggatttgtcaaaagaatccttcttgttgctgtcctgcattaagtcctgtggtgga
cggtggggccttaatttgcctattgatgttctccgtggatcacgtgtcaagaaaatagtt
gaaaacaattttgataaacttccattgcatgggcggggaaaagactatccaccaaactgg
tggaaagctcttggcggcctgcttttagcacatgattatttgaaggagactgtccatgat
acatttagatccatcagtgttagtcctaatgggtacaagtttctatccactgctgataaa
ggggatggagcatcgctgtttttacagctgactgcagagatgattgagctagaggggcat
ggtggttcacagtgtaaagaagagggcttaaatcctttgggcccatcagaatctgaaaaa
atttctgaggatgaattgaaaatctaccaagtactcttgaatgtcaggatgcaacttgca
caagatattggaacggcgccgtacgctatatgtggtgatcagacactaagaaactttgcg
aagttcaggcctagcaccatagctaggttggctaatattgatggtgttaaccagcacttc
atctcgcattacggcagtattttcatccaaaatatcacacaattggcaaaagaattgaat
cttcctgtggatgatttatcggctgtagaaagtatacctgctgctccaaaacctacacaa
aataatctcccaaggagtttgggtggcgcgaaattttgttcatgggaattgtggcagaaa
atgaagttttcgttccagaaagttgcgcattaccgcagagcagtaccaataaaagagaaa
acagtcatttcctacatacttgatgctgctcgagatggatgtgagatggactggagtagg
ttttgtgaggaggtaggacttacacatgagatagcctcacagatccgtcttgccattaca
aagcttggatcacatgaaaagttgaagccaatcaaagatgaacttccagaaaatgtaact
tatgagatgatccagacattcttggcaattgagggacttggattgtcggatcaagttttt
ggtactgttcctactgatgggatccagtccaagacatcagaggcaccaaagaccacctcc
aatggaggtgaagttggcgcagatgtttgtgatgcaagccctttgacaaggagaggccaa
actgatgggtcattgatttgtggtgatgagccagcaagtaaactacaaaagatagacggg
caaggtgtaaattctactgccgcaatcggtgccacagaggatgcaatactagaactggtt
gaaggacgcaatgggttgttgcaggtttcgttggaggatgttgtcaagcacttcaatggg
tcgaaaagagaatgtgtcgtcgagatgttggacaatctggaaggcaattttctggtgtac
aagaagaatggctgctacatgattatgtga

DBGET integrated database retrieval system