KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344541
Entry
4344541           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial isoform X2
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4344541
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4344541
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     4344541
SSDB
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2 Fer4_7 Fer4_9
Other DBs
NCBI-GeneID: 4344541
NCBI-ProteinID: XP_015650211
UniProt: Q9S827
LinkDB
Position
8:complement(1091207..1094685)
AA seq 281 aa
MAAAALLRRSPAARALLSPALSSRLVASKPHSSSPAPPPPPSKAGANTKTFSIYRWDPDS
PSTKPHLKDYKVDLSDCGPMVLDVLLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGL
ACLTKISSASSASTISPLPHMFVIKDLVVDMTNFYNQYKSVEPWLKRKDAPPQPGKEIPQ
TKADRAKLDGMYECILCACCSTSCPSYWWNPEEYLGPAALLHANRWIQDSRDQFTKERLD
SINDEFKLYRCHTIKNCTHACPKGLNPAKHIDTIKKLQLEA
NT seq 846 nt   +upstreamnt  +downstreamnt
atggccgccgccgccctcctccgccgctcgccggcggcgcgcgccctcctctccccggcg
ctctcctcccgcctcgtcgcctccaagccccactcgtcgtcccccgcgccgccgccgccg
ccgtcgaaggcgggggcgaacaccaagacgttctcgatctacaggtgggatcccgactcg
ccgtcgacgaagccccacctcaaggactacaaggtggacctctccgactgcgggccgatg
gtgctcgacgtgctgctcaagatcaagaacgagcaggacccgtcgctcaccttccgccgc
agctgccgcgaggggatctgcgggagctgcgcgatgaacatcgacggcgacaatggcctc
gcctgcctcaccaagatctcgtcggcgtcctcggcctccacgatctcgccgctcccccac
atgttcgtcatcaaggacctcgtcgtcgacatgaccaacttctacaaccagtacaagagc
gtggagccgtggctcaagcgcaaggacgcgccgccgcagcccgggaaggagatcccgcag
accaaggccgaccgcgccaagctcgacggcatgtacgagtgcatcctctgcgcctgctgc
tccacctcctgcccctcctactggtggaaccccgaggagtacctcggccccgccgcgctc
ctccacgccaacaggtggatacaggacagccgtgaccagttcactaaggagcgcctggat
tccatcaacgacgagttcaagctgtaccgctgccacaccatcaagaactgcacacacgcc
tgccccaagggcctcaacccagcgaagcacatcgacacaatcaagaagctccagctcgag
gcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346890
Entry
4346890           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4346890
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4346890
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     4346890
SSDB
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_18 Fer4_16
Other DBs
NCBI-GeneID: 4346890
NCBI-ProteinID: XP_015611366
UniProt: Q6H4G3
LinkDB
Position
9:complement(12295665..12296751)
AA seq 311 aa
MILRRTLPRLASAKDGSGGGFADGHFPSLRGHPAARANARDAAEKQAALAAKEEEIRDHR
RGDAAAASPAPSTVKEFRVYRWSPDAPSRRPHLQSYHVDLATCGPMVLDVLQKIKAEHDA
TLAFRRSCREGICGSCSMCIDGVNTVACLRPVDTDTSSATTVTPLPHMYVVRDLVVDLTS
FYQQYKSVEPWLKRKTKTKTETTEHAQSPEERKRLDGLYECILCACCSAACPSYWWNAEA
FLGPAALLHAYRWVSDSRDEYAAERVQALAEGWDKLYRCRMIKSCTATCPKSLDPAAAIS
AMKTLHQLGKP
NT seq 936 nt   +upstreamnt  +downstreamnt
atgattctgcggaggacgctgccgaggctggcctcggcgaaggacggcagcggcggcggc
ttcgccgacggccacttcccctccctccgcggccaccccgccgcgcgcgccaacgcgcgg
gacgccgccgagaagcaggcggcgctggctgcgaaggaggaggagatcagggaccaccgg
cgcggcgacgccgcggcggcgtcgccggcgccgtcgacggtgaaggagttccgggtgtac
cggtggagcccggacgccccctcgcggcggccgcacctgcagtcgtaccacgtcgacctc
gccacatgcggtcccatggtgctggacgtcctgcagaagatcaaggcggagcacgacgcg
acgctggcgttccggcggtcgtgccgggagggcatctgcgggtcgtgctccatgtgcatc
gacggggtgaacaccgtggcgtgcctcaggcccgtggacaccgacacctcgtcggccacg
acggtgacgccgctgccccacatgtacgtcgtgagggacctcgtcgtcgacctgaccagc
ttctaccagcagtacaagtcggtggagccgtggctgaagaggaagacgaagacgaagacg
gagacgacggagcacgcgcagtcgccggaggagaggaagaggctggacgggctgtacgag
tgcattctgtgcgcgtgctgcagcgcggcgtgcccgtcctactggtggaacgcggaggcg
ttcctggggccggcggcgctgctgcacgcgtaccggtgggtgtcggacagccgcgacgag
tacgcggcggagcgggtgcaggcgctggcggaggggtgggacaagctctaccgctgccgg
atgatcaagagctgcacggccacctgccccaagagcctcgaccccgccgccgccatctcc
gccatgaagaccctgcaccagctcggcaagccatga

DBGET integrated database retrieval system