KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344590
Entry
4344590           CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P0
  KO
K02941  large subunit ribosomal protein LP0
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344590
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4344590
SSDB
Motif
Pfam: Ribosomal_L10 Ribosomal_60s RL10P_insert
Other DBs
NCBI-GeneID: 4344590
NCBI-ProteinID: XP_015650041
UniProt: P41095
LinkDB
Position
8:complement(1720418..1723146)
AA seq 319 aa
MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT
LIRRCIKVHADNTGNKEFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA
PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK
LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAA
PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKFAVAAPVAADSGAAAPSAAKEEE
KKEEPEEESDGDLGMSLFD
NT seq 960 nt   +upstreamnt  +downstreamnt
atggcgatcaagaggaccaaggcggagaagaaggtggcgtacgacaagaagctctgccag
cttctcgacgagtacaccaaggtgctcatcgccgtcgccgacaacgtcgggtccaaccag
ctgcaggagatccgcaagggcctcaggggcgactccatcgtcctcatggggaagaacacc
ctcatccgccgctgcatcaaggtgcacgccgacaacaccggcaacaaggagttcctcgag
ctcatgcccctcctcgtcggaaacgttggcctcatcttcaccaagggtgacctcaaggag
gtccgcgaggaggttgccaagtacaaggttggagctcctgctcgtgttggtcttgttgct
cctgttgatgtggtggttccccctggcaacactggtctggatccatcccagacctctttc
ttccaggtgcttaacatccccaccaagattaacaagggtactgtggaaattatcacccct
gtggagctcattaagaagggtgacaaggtgggctcctccgagtctgctctgcttgccaag
cttggtatccgccccttctcatatgggctggttattaccaatgtctatgacagtgggtca
gtcttcagccctgaggtgcttgacctcactgaggatgacctgatggagaagtttgcttct
ggtgtttctatggttgcctcagtctccctggcaatctcgtacccaactattgctgctgca
ccacacatgttcctcaatgggtacaagaatgtgcttgctgttgctgtggagaccgaatac
tcgtacccacatgctgataagatcaaggagtatttgaaagaccccagcaagttcgctgtt
gctgccccagttgccgccgacagtggtgctgctgctccatcggctgccaaggaggaagag
aagaaggaagagcccgaggaggagtccgatggtgacctgggcatgagcctcttcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266027
Entry
9266027           CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P0-like
  KO
K02941  large subunit ribosomal protein LP0
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9266027
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9266027
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9266027
SSDB
Motif
Pfam: Ribosomal_60s Ribosomal_L10 RL10P_insert
Other DBs
NCBI-GeneID: 9266027
NCBI-ProteinID: XP_015615565
UniProt: Q2RAW0 A0A8J8XXU0
LinkDB
Position
11:complement(1646476..1648988)
AA seq 320 aa
MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT
LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA
PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK
LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA
PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKFAVAAAVAAADSGAAAPAASKEE
EKKEEPEEESDGDLGMSLFD
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcgatcaagcggaccaaggcggagaagaaggtggcgtacgacaagaagctgtgccag
cttctggacgagtacaccaaggtgctcatcgccgtcgccgacaacgtgggatccaaccag
ctgcaggagatccgcaaggggctcaggggcgactccatcgtcctcatgggcaagaacacc
ctcatccgccgctgcatcaaggtgcacgccgacaacaccggcaacaaggacttcctcgag
ctcatgcccctcctcgtcggaaacgttggtctcatcttcaccaagggtgacctcaaggag
gtccgcgaagaggtcgccaagtacaaggttggagctcctgctcgtgttggtctggttgct
cctgttgatgtggtggttccccctggaaacactggtctggatccctcccagacttctttc
tttcaggtgcttaacatccccaccaagattaacaagggtaccgtggaaattatcacccct
gtggagctcattaagaagggtgacaaggttggctcctctgagtctgccctgcttgccaag
cttggtatccgccccttctcatatgggctggtgatcaccaatgtgtacgacagtgggtca
gtcttcagccctgaggtgctcgacctcactgaagaggacctgatggagaagtttgcatct
ggtgtttcgatggttgcctcagtgtccctggcaatctcatacccaactattgctgctgcg
ccacacatgttcctcaatgggtacaagaatgtgcttgctgttgctgtggagaccgaatac
tcatacccacatgctgataagatcaaggagtatttgaaggaccccagcaagtttgctgtt
gctgccgctgttgctgctgctgacagtggcgctgctgctccagctgcttccaaggaggaa
gagaagaaggaagagcccgaggaggagtctgacggtgacctgggcatgagcctcttcgac
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270965
Entry
9270965           CDS       T01015                                 
Name
(RefSeq) 60S acidic ribosomal protein P0-like
  KO
K02941  large subunit ribosomal protein LP0
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9270965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9270965
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9270965
SSDB
Motif
Pfam: Ribosomal_L10 RL10P_insert Ribosomal_60s
Other DBs
NCBI-GeneID: 9270965
NCBI-ProteinID: XP_015618323
UniProt: Q2QY46 A0A8J8XJN7
LinkDB
Position
12:complement(1601955..1604457)
AA seq 320 aa
MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNT
LIRRCIKVHADNTGNKDFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVA
PVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK
LGIRPFSYGLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAA
PHMFLNGYKNVLAVAVETEYSYPHADKIKEYLKDPSKFAVAAPVAAADSGAAAVASSKEE
EKKEEPEEESDGDLGMSLFD
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcgatcaagcggaccaaggcggagaagaaggtggcgtacgacaagaagctgtgccag
cttctggacgagtacaccaaggtgctcatcgccgtcgccgacaacgtgggatccaaccag
ctgcaggagatccgcaaggggctcaggggcgactccatcgtcctcatggggaagaacacc
ctcatccgccgctgcatcaaggtgcacgccgacaacaccggcaacaaggacttcctcgag
ctcatgcccctcctcgtcggtaacgttggtctcatcttcaccaagggtgacctcaaggag
gtccgcgaggaggtcgccaagtacaaggttggagctcctgctcgtgttggtctggttgct
cctgttgatgtggttgttccccctggaaacactggtctcgatccctcccagacttctttc
ttccaggtgcttaacatccccaccaagattaacaagggtactgtggaaattatcacccct
gtagagctcattaagaagggtgacaaggttggctcctctgagtctgccctgcttgccaag
cttggtatccgccccttctcatatgggctggtgatcaccaatgtgtacgacagtgggtca
gtcttcagccctgaggtgctcgacctcactgaagaggacctgatggagaagtttgcatct
ggtgtttcgatggttgcctcagtgtccctggcaatctcatacccaactatcgcagctgcg
ccacacatgttcctcaatgggtacaagaatgtgctcgctgttgctgtggagaccgaatac
tcatacccacatgctgacaagatcaaggagtatttgaaggaccccagcaagtttgctgtt
gctgcccctgttgctgctgctgacagtggcgctgctgctgtagcttcttccaaggaggaa
gagaagaaggaagagcccgaggaagaatctgacggtgacctgggcatgagcctcttcgac
taa

DBGET integrated database retrieval system