KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344698
Entry
4344698           CDS       T01015                                 
Name
(RefSeq) mitogen-activated protein kinase 2
  KO
K20600  mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4344698
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4344698
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4344698
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     4344698
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   4344698
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like ABC1
Other DBs
NCBI-GeneID: 4344698
NCBI-ProteinID: XP_015650444
UniProt: Q5J4W4
LinkDB
Position
8:3307514..3310591
AA seq 394 aa
MRMEGGGGGGHGHHGGGGGGHGHHGGIGGGEAQIKGTLTHGGRYVQYNVYGNLFEVSSKY
VPPIRPVGRGACGIICAVVNAQTRQEVAIKKIGNAFDNQIDAKRTLREIKLLRHMDHDNV
ISIKDIIRPPRRENFNDVYIVYELMDTDLHHLLRSNQPLTDDHCQYFLYQVLRGLKYVHS
ANVLHRDLRPSNLLLNAKCDLKIGDFGLARTTNETDFMMEYVVTRWYRAPELLLNCSEYT
AAIDIWSVGCILGEIVTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRS
LPQYPKQQFRARFPTMSSGAMDLLERMLVFDPSKRITVDEALCHPYLASLHEIYDEPVCP
APFSFDFEQPSLTEEDIKEIIWREALKFNPEPIH
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgcgcatggagggcggcggcggcggcggccatggccatcacggcggcggcggcggtggc
catggccatcacggtggcatcggaggaggggaggcgcagatcaaggggacgctgacgcac
ggcgggaggtacgtgcagtacaacgtgtatggtaacctgttcgaggtttcgtccaagtac
gtccctcccatccgccccgtcggccgcggcgcctgcggcatcatctgtgcggttgtgaat
gcgcagactcgtcaggaggtggcaatcaagaagatcggcaacgcgttcgacaaccagatc
gacgccaagcgcaccctgcgagagatcaagctgcttcggcacatggatcatgataatgtc
atctcaataaaggacatcatacggccaccaaggagggagaacttcaatgatgtctacatt
gtctatgagctcatggacactgatcttcaccaccttcttcgatcaaaccagccactaaca
gatgatcactgtcagtattttctctatcaggtactacgaggattgaagtatgtgcattca
gcaaatgtcttgcacagagacctcaggccaagtaatttgctgctgaatgcgaaatgcgat
cttaagatcggagactttggattagcaaggaccacaaatgaaactgacttcatgatggag
tatgttgttactcgatggtacagggcacctgaactcctgctaaactgctcagagtacact
gcagctattgatatctggtcggtaggctgcatccttggtgagatcgttacaagggagcct
ttgtttcctggaaaggattatgtccatcagctgaggctaataactgagttaataggctca
cctgatgactcgagccttgggtttcttcgaagcgacaacgcccgcagatatgtgaggtcg
cttcctcaataccccaagcaacaattccgtgcacggttccccactatgtctagtggtgcc
atggatttgcttgagaggatgcttgtgtttgatcccagcaaaaggattactgttgatgaa
gctctgtgccatccatacttggcatcccttcatgagatatatgatgaaccagtctgccca
gcgcctttcagcttcgatttcgagcagccgtcgctcaccgaagaagatatcaaggagatc
atatggagggaggcacttaagttcaaccctgaaccaattcactag

DBGET integrated database retrieval system