KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344703
Entry
4344703           CDS       T01015                                 
Name
(RefSeq) protein LHY isoform X1
  KO
K12133  MYB-related transcription factor LHY
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4344703
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4344703
Transcription factors [BR:osa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    4344703
SSDB
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_7 Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 4344703
NCBI-ProteinID: XP_015649835
UniProt: Q6ZD85
LinkDB
Position
8:3360845..3373396
AA seq 725 aa
MEINSSGEEAVVKVRKPYTITKQRERWTEAEHNRFLEALKLYGRAWQRIEEHVGTKTAVQ
IRSHAQKFFTKLEKEAINNGTSPGQAHDIDIPPPRPKRKPNSPYPRKSCLSSETSTREVQ
NDKATISNMTNNSTAQMAGDAALEKLTYIQKLQRKEISEKGSCSEVLNLFREVPSASFSS
VNKSSSNHGASRGLEPTKTEVKDVVILERDSISNGAGKDAKDINDQEMERLNGIHISSKP
DHSHENCLDTSSQQFKPKSNSVETTYVDWSAAKASHYQMDRNGVTGFQATGTEGSHPDQT
SDQMGGASGTMNQCIHPTLPVDPKFDGNAAAQPFPHNYAAFAPMMQCHCNQDAYRSFANM
SSTFSSMLVSTLLSNPAIHAAARLAASYWPTVDGNTPDPNQENLSESAQGSHAGSPPNMA
SIVTATVAAASAWWATQGLLPLFPPPIAFPFVPAPSAPFSTADVQRAQEKDIDCPMDNAQ
KELQETRKQDNFEAMKVIVSSETDESGKGEVSLHTELKISPADKADTKPAAGAETSDVFG
NKKKQDRSSCGSNTPSSSDIEADNAPENQEKANDKAKQASCSNSSAGDNNHRRFRSSAST
SDSWKEVSEEGRLAFDALFSRERLPQSFSPPQVEGSKEISKEEEDEVTTVTVDLNKNAAI
IDQELDTADEPRASFPNELSNLKLKSRRTGFKPYKRCSVEAKENRVPASDEVGTKRIRLE
SEAST
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggagattaattcctctggtgaggaagcggtggtaaaggtgaggaagccatacacaatc
acaaagcagagggagcgttggactgaggcagagcacaacaggttccttgaagccttgaaa
ctgtatgggagagcctggcagcgcatagaagagcatgttgggacaaagacagctgtgcag
atcagaagtcatgctcaaaagttcttcaccaagttggaaaaggaagctatcaacaatggc
acttctccaggacaagctcatgacatcgacatacctccaccacgaccaaaaagaaaacct
aacagtccatatcctcgaaaaagttgtctcagctctgagacatccaccagggaagttcaa
aatgataaggcaacaatatcaaatatgacgaacaatagcactgcacaaatggcaggtgat
gcagctcttgagaaactcacttacattcagaaacttcaaagaaaggagatatctgaaaaa
ggaagttgctccgaagttcttaatctctttcgagaagtcccatcggcatcattttcttca
gttaacaaaagctcttcaaatcatggtgcatccagggggctggaaccgactaaaacagaa
gtcaaagatgtggtcatcttggaaagggattctatttccaatggtgcagggaaggatgca
aaagatatcaatgatcaagaaatggaaaggctcaatgggatacacatcagctcgaagcct
gatcattctcatgaaaactgtttggatacctcaagccaacaatttaagccaaaatcaaac
tctgtggagacaacatatgtggattggtctgctgcaaaagcttcacactaccaaatggac
agaaatggggttactggctttcaagccactggaactgaaggaagccatcctgatcaaaca
agtgatcaaatgggaggagccagcggaactatgaatcaatgcatccatccaacacttcct
gtggatccaaaattcgacggcaatgccgcagcacagccctttcctcacaactatgcagcc
tttgcaccaatgatgcaatgccactgcaaccaagatgcctacagatcttttgccaatatg
tcatccaccttctccagcatgcttgtctccacattgttgtcaaaccctgcaatccatgca
gctgccaggcttgcagcatcgtactggcctacagtagacggcaatactcctgatccaaat
caagaaaatctttctgagagtgctcaaggaagccacgctggctctcctcccaacatggca
tctattgtcacagctacagttgctgcagcatcagcatggtgggcaacacaaggtcttctc
cctctttttcctccacctatagcttttccatttgttccagctcctagtgctcccttttcc
acagcagatgttcagcgagctcaagagaaagatatagactgcccaatggataatgcacag
aaggaattgcaagaaactcggaaacaagataattttgaagctatgaaggtcatagtgtct
tcagagactgatgagagtggaaaaggagaagtgtcgctccacactgagttaaagatatct
ccagcagataaggccgacaccaaacctgccgcaggagctgaaacaagtgacgtttttgga
aataagaaaaagcaggatcgctcttcatgtggttccaacacaccgtcaagtagtgatata
gaagcagataatgctcctgagaatcaagaaaaggctaacgacaaggcaaagcaagcatct
tgcagtaactcttcagccggtgacaataaccaccgtagatttaggagcagtgcaagcaca
agtgattcatggaaggaagtttctgaagagggtcgtctggcttttgatgcactgttcagt
agagaaaggcttccccaaagcttttctcctccgcaagtagaaggatcaaaggagattagc
aaggaggaagaagatgaagtaaccacggtgacggttgacctcaacaagaatgccgctatt
attgatcaagaactcgacacagcggatgagccaagagcttcctttcctaatgaattgtca
aacctgaagctgaaatctcgcaggaccggtttcaaaccatacaagaggtgctcagtggaa
gcgaaggagaacagggtaccggctagcgatgaggttggtaccaagaggattcgtcttgag
agcgaagcatcgacatga

DBGET integrated database retrieval system