KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344716
Entry
4344716           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 42
  KO
K12811  ATP-dependent RNA helicase DDX46/PRP5 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4344716
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4344716
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4344716
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    4344716
 Complex B
    4344716
SSDB
Motif
Pfam: DEAD Helicase_C
Other DBs
NCBI-GeneID: 4344716
NCBI-ProteinID: XP_015650120
UniProt: Q84UQ1
LinkDB
Position
8:complement(3513835..3518796)
AA seq 1049 aa
MGSSDEAGSSKHHRRDKEKDRERSSSRHHRDRDRERSSSRHHHREDRDDDRDRDRDRERR
HREKERDREERKAREREEREKEKERERARRREERDREERSRRREAAAEEEEEDVDRDRKR
RRRSSHHHHHHRDAEPEGPASGAREEEVVDVEEAERRRQKKKEEEQKQLDEEMETRRRRI
KEWQEMKRREEETKRREQEEAGVGTSAAAAAAPAEAEDGGNAGKKWTLDGEESDEEGNQE
DGKKSDDNGGSGAGAMDVDVPNGGDNANGANAMDEDEIDPLDAFMNSMVLPEVAKLESMP
AANVDDKNDKSAKDAVTNGDKKGPKKVMGRIIQGEDSDSDYADDEDDEGGSEDEDDEEFM
KRVKKTKAEKLAIVDHSKIDYQPFRKNFYIEVKDITKMAAEEVAAYRKQLELKVHGKDVP
KPIKTWVQSGLTSKLLDTIKKLGFEKPMSIQAQALPIIMSGRDCIGIAKTGSGKTLAFVL
PMLRHVKDQPAVVPGDGPIGLIMAPTRELVVQIHSDIKKFSKALGINCVAIYGGSGVAQQ
ISELKRGAEIVVCTPGRMIDILCTSSGKITNLRRVTFLVMDEADRMFDMGFEPQITRIVQ
NTRPDRQTVLFSATFPRQVEILARKVLTKPVEIQVGGRSVVNKDITQLVEVRPENERFFR
LLELLGEWFDKGKILVFVHSQDKCDSLLKDLFQHGYPCLSLHGGKDQTDRESTLADFKSN
VCSLLIATSVAARGLDVKELELVVNYDVPNHYEDYVHRVGRTGRAGRKGFAVTFISEEEE
RYAPDLVKALELSEQAVPEDLKGLADRFMAKVKQGTEQAHGTGYGGSGFKFNEEEDEARK
SAKKAQAREYGYEEDKSDSDSDEEGGVRKAGGDLAAQAIAAAQAAAAMVAAKAASNANQQ
TQGTSVGPLLPLAIASNTQNNEATARALQAAFNIQQNLARIQAHAVPEHYEAELEINDFP
QNARWKITHKETLGPIQEWTGAAITTRGTFFPQGKIVGANERKLYLFIEGPTELSVKKAK
AELKRVLEDCANHALNLPGSAQTGKYSVI
NT seq 3150 nt   +upstreamnt  +downstreamnt
atggggtctagcgacgaggccggctcctccaagcaccaccgccgcgacaaggagaaggac
cgcgagcggtcctcctcccgccaccaccgcgaccgcgaccgcgagagatcctcctctcgc
caccaccaccgcgaggaccgggatgacgaccgggatcgggaccgggaccgggagcgccgc
cacagggagaaggagcgggatcgcgaggagcggaaggcgcgggagcgggaggagcgggag
aaggagaaggagagggagcgtgcgcggcggcgcgaggagagggaccgcgaggagaggtcg
aggaggcgggaggcggcggcggaggaggaggaggaggatgtggaccgcgaccgcaagcgc
cgccgccggtcgtcgcaccaccaccaccaccaccgcgacgcggagccggaggggccggct
tcgggggccagggaggaggaggtggtggatgtggaggaggccgagaggcggcgccagaag
aagaaggaggaggagcagaagcagctggacgaagagatggagacgcggcgccgccgcatc
aaggagtggcaggagatgaagcgccgcgaggaggagacgaagcgccgcgagcaggaggag
gccggagttggcacctcagccgccgccgccgcggcccccgcagaagcagaagatggcggc
aatgccgggaagaagtggaccttggatggcgaggagtctgatgaggaggggaaccaagag
gatggtaagaaatccgatgataatggtggttctggtgccggtgccatggacgttgatgtt
ccaaatgggggtgataatgcaaacggcgccaatgctatggatgaagatgagattgatccg
cttgatgcgttcatgaactcgatggtattgcctgaggtcgcaaagcttgagagcatgcct
gctgccaatgtggatgacaagaatgataagagtgctaaggatgctgtgactaatggggat
aaaaaggggccaaagaaggtgatggggagaattatacaaggagaagactcagactcggat
tatgcagatgacgaggatgatgagggtggttccgaagatgaggatgatgaggagttcatg
aaacgtgtcaagaagacaaaggcagaaaagttggctattgttgaccattctaagatcgac
taccagccgttccggaagaatttctacattgaggtgaaggatattacaaagatggcagct
gaggaagtggcagcttatcggaagcagttggagctcaaggtgcatgggaaagatgtaccc
aagccaataaagacatgggtgcagagtgggcttaccagcaagctccttgatacaatcaag
aaacttggtttcgagaaaccgatgtctatacaggcacaagcactgccgatcataatgagt
gggcgtgattgtataggaattgcaaagactggatcaggcaagactctagcatttgtcctg
cctatgctgaggcatgtcaaagatcagccggctgttgttcctggagatggcccaattggg
cttataatggctcctactagagagcttgtggtgcagatacattcagacattaagaagttt
tcgaaggcgcttggcatcaactgtgttgctatctatggaggttctggagttgcccagcag
atcagtgaactgaagaggggtgctgaaattgttgtttgtacaccaggcaggatgattgat
attctttgcacaagcagtgggaagattactaatcttcggagagttacattcttggtgatg
gatgaagctgataggatgtttgatatgggttttgagcctcagattactcggatagttcag
aatactcgtccagataggcagacagttcttttctcagccacttttccacgtcaggtggag
atactggcccgtaaggtgctgacaaagcctgttgagatccaggtgggtgggaggagtgtc
gtcaacaaagatatcacacaactggttgaggtgcggccagaaaatgagaggttctttagg
ctgttggagctgcttggagagtggtttgataaaggtaaaattcttgtttttgtccattca
caagataaatgtgattctctactcaaagacctgttccagcatggatatccatgcctatcc
ctgcatggtgggaaagaccagactgaccgtgaatcaacactagctgatttcaagagcaat
gtgtgcagcttgctgattgctaccagtgttgctgctaggggtttagatgtcaaggagctt
gagcttgttgtgaattatgatgtcccgaaccactatgaggattatgttcatcgtgttgga
cgaactggacgtgctgggaggaagggatttgccgtgacttttatttctgaggaagaggag
cgttatgctccagaccttgttaaagctttggagctctcagagcaggctgttccagaggac
ctgaaaggtctagctgatcgttttatggcaaaggtgaagcagggaacagagcaggcccat
ggaacaggatatggtggaagcggtttcaagttcaatgaagaggaggatgaagcacggaaa
tctgcaaagaaggctcaggcaagggaatatggttatgaggaggacaagtcagattcagat
tctgatgaggaaggaggggttcgtaaggcgggaggtgaccttgcggcacaagctattgct
gctgctcaagctgctgctgctatggttgcagcaaaggctgctagcaatgccaaccagcaa
acacaaggcacttctgtagggcccttgcttcctctagccattgcttcaaacacacagaat
aacgaggccacagcacgtgcactgcaggctgcatttaacatacagcaaaatctggcaagg
atacaagcacatgcagtcccagaacattatgaggctgagcttgagattaatgatttccca
caaaatgcccgctggaagatcactcacaaagaaacattgggtcctatccaggaatggacg
ggtgctgcaatcactacaaggggaaccttttttcctcaaggaaaaattgttggtgctaat
gaacgcaagctgtacctgttcatagagggccccactgagctatctgtcaagaaggcgaaa
gcagaattgaagcgtgtccttgaagattgtgccaaccatgctctgaaccttcctggttct
gcccaaactggaaagtactctgttatttga

DBGET integrated database retrieval system