KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344737
Entry
4344737           CDS       T01015                                 
Name
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4344737
   03410 Base excision repair
    4344737
   03420 Nucleotide excision repair
    4344737
   03430 Mismatch repair
    4344737
   03440 Homologous recombination
    4344737
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4344737
   03400 DNA repair and recombination proteins [BR:osa03400]
    4344737
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4344737
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4344737
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     4344737
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 4344737
NCBI-ProteinID: XP_015649425
UniProt: Q0J7T7
LinkDB
Position
8:complement(3727995..3728870)
AA seq 122 aa
MRSGGDVRSFFRQQKAHAAGGVKPTGGVSKKAALPRHHHKPASQATPDRAVDDARRHVEE
AEEEEGRERMAREFDMDMRYGPCLGLTRAQRWRRAAALGLAPPPAVIAVCSDDQPCLWEG
RV
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaggagcggcggcgacgtcaggtccttcttccggcagcagaaggcccacgccgccggc
ggcgtcaagcccaccggcggcgtctccaagaaggcggcgctgccccgccaccaccacaag
cccgcgtcgcaggcgacgccagatcgcgccgtcgacgacgcgaggaggcacgtcgaggag
gcggaggaggaggaggggcgggagaggatggctcgggagttcgacatggacatgcggtac
gggccctgcctcggcctcacccgcgcccagcgctggcgccgcgccgccgcgctcggcctc
gccccgccgcccgccgtcatcgccgtctgctccgacgaccagccgtgcctctgggagggc
cgcgtctag

DBGET integrated database retrieval system